Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.44
PubTator Score 6.29

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
25515583 the TNfnIII 1-5 repeats play an important role in PCO pathology.
25144706 we find evidence for many novel candidates, the strongest of which is FANK1, an imprinted gene that suppresses apoptosis, is expressed during meiosis in males.
20978819 found that Jab1 (Jun activation domain-binding protein 1), a co-activator of AP-1, specifically interacted with Fank1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18682798 Observational study of gene-disease association. (HuGE Navigator)
17604233 FANK1 may have a role in regulating gene expression in the transition from the meiotic phase to the haploid phase during spermatogenesis

AA Sequence

MEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKH      1 - 70
VVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVP     71 - 140
NKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGG    141 - 210
CTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKT    211 - 280
PLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC         281 - 345
//

Text Mined References (13)

PMID Year Title
25515583 2014 Targeting the fibronectin type III repeats in tenascin-C inhibits epithelial-mesenchymal transition in the context of posterior capsular opacification.
25144706 2014 A model-based approach for identifying signatures of ancient balancing selection in genetic data.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20978819 2011 Fank1 interacts with Jab1 and regulates cell apoptosis via the AP-1 pathway.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18682798 2008 Genes to diseases (G2D) computational method to identify asthma candidate genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17604233 2007 Fank1 is a testis-specific gene encoding a nuclear protein exclusively expressed during the transition from the meiotic to the haploid phase of spermatogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...