Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
R01 Count 2
Funding $208,121.25
PubMed Score 10.24
PubTator Score 7.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TC71 B4E2R0 E5RLK1 Q8IY48 Q8N7D7
Symbols Mieap
SPETEX1

Gene

 Grant Application (2)

Gene RIF (5)

PMID Text
22292033 The physical interaction of Mieap, BNIP3 and NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix.
21300779 show that SPATA18 transcription is induced by p53 in a variety of cell types of both human and mouse origin
21264228 Mieap induced vacuole-like structures (designated as MIV for Mieap-induced vacuole), which engulfed and degraded the unhealthy mitochondria by accumulating lysosomes
21264221 Mieap induces intramitochondrial lysosome-like organella that plays a critical role in mitochondrial quality control by eliminating oxidized mitochondrial proteins
16088906 beta-sarcoglycan and SPATA18 may have a role in limb-girdle muscular dystrophy type 2E

AA Sequence

MAENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDG      1 - 70
VETIKSRLLPWLEASFTAASLGKSVDSKVPSLQDTFDRERHKDPSPRDRDMQQLDSNLNSTRSQCNQVQD     71 - 140
DLVETEKNLEESKNRSAISLLAAEEEINQLKKQLKSLQAQEDARHRNTDQRSSENRRSEPWSLEERKREQ    141 - 210
WNSLKQNADQQDTEAMSDYKKQLRNLKEEIAVLSAEKSALQGRSSRSRSPSPAPRSRSCSRSRSASPSTA    211 - 280
VKVRRPSPNRSKLSNVARKAALLSRFSDSYSQARLDAQCLLRRCIDKAETVQRIIYIATVEAFHVAKMAF    281 - 350
RHFKIHVRKSLTPSYVGSNDFENAVLDYVICHLDLYDSQSSVNDVIRAMNVNPKISFPPVVDFCLLSDFI    351 - 420
QEICCIAFAMQALEPPLDIAYGADGEVFNDCKYRRSYDSDFTAPLVLYHVWPALMENDCVIMKGEAVTRR    421 - 490
GAFWNSVRSVSRCRSRSLSPICPRSQIGLNTMSRSRSPSPIRCGLPRF                          491 - 538
//

Text Mined References (10)

PMID Year Title
22292033 2012 BNIP3 and NIX mediate Mieap-induced accumulation of lysosomal proteins within mitochondria.
21300779 2011 SPATA18, a spermatogenesis-associated gene, is a novel transcriptional target of p53 and p63.
21264228 2011 Mieap, a p53-inducible protein, controls mitochondrial quality by repairing or eliminating unhealthy mitochondria.
21264221 2011 Possible existence of lysosome-like organella within mitochondria and its role in mitochondrial quality control.
16088906 2005 Homozygous microdeletion of chromosome 4q11-q12 causes severe limb-girdle muscular dystrophy type 2E with joint hyperlaxity and contractures.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15236321 2004 Complementary DNA cloning of rat spetex-1, a spermatid-expressing gene-1, encoding a 63 kDa cytoplasmic protein of elongate spermatids.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.