Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.00
PubTator Score 7.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis 1.062 1.9e-02
acute quadriplegic myopathy 1.051 4.5e-10
Astrocytoma, Pilocytic 2.100 4.8e-07
atypical teratoid / rhabdoid tumor 1.400 2.1e-02
Breast cancer -2.000 1.1e-04
chronic rhinosinusitis -1.927 2.8e-02
cystic fibrosis 1.269 4.4e-03
ependymoma 3.700 1.2e-11
glioblastoma 1.200 4.1e-03
group 3 medulloblastoma 1.500 2.9e-03
intraductal papillary-mucinous adenoma (... 1.900 1.8e-03
invasive ductal carcinoma -1.500 1.0e-02
lung adenocarcinoma -1.200 3.2e-08
medulloblastoma, large-cell 1.800 1.6e-07
nasopharyngeal carcinoma -2.600 9.7e-04
non-small cell lung cancer -1.024 7.7e-07
osteosarcoma 1.094 6.9e-06
ovarian cancer 1.200 5.6e-11
pituitary cancer -1.100 4.5e-03
primitive neuroectodermal tumor 1.100 3.1e-02
subependymal giant cell astrocytoma 2.544 8.7e-03

Gene RIF (5)

AA Sequence

MAENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDG      1 - 70
VETIKSRLLPWLEASFTAASLGKSVDSKVPSLQDTFDRERHKDPSPRDRDMQQLDSNLNSTRSQCNQVQD     71 - 140
DLVETEKNLEESKNRSAISLLAAEEEINQLKKQLKSLQAQEDARHRNTDQRSSENRRSEPWSLEERKREQ    141 - 210
WNSLKQNADQQDTEAMSDYKKQLRNLKEEIAVLSAEKSALQGRSSRSRSPSPAPRSRSCSRSRSASPSTA    211 - 280
VKVRRPSPNRSKLSNVARKAALLSRFSDSYSQARLDAQCLLRRCIDKAETVQRIIYIATVEAFHVAKMAF    281 - 350
RHFKIHVRKSLTPSYVGSNDFENAVLDYVICHLDLYDSQSSVNDVIRAMNVNPKISFPPVVDFCLLSDFI    351 - 420
QEICCIAFAMQALEPPLDIAYGADGEVFNDCKYRRSYDSDFTAPLVLYHVWPALMENDCVIMKGEAVTRR    421 - 490
GAFWNSVRSVSRCRSRSLSPICPRSQIGLNTMSRSRSPSPIRCGLPRF                          491 - 538
//

Text Mined References (10)

PMID Year Title