Property Summary

NCBI Gene PubMed Count 36
Grant Count 20
R01 Count 10
Funding $2,246,859.7
PubMed Score 142.67
PubTator Score 62.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell 2.600 0.012
intraductal papillary-mucinous neoplasm ... -1.100 0.025
gastric carcinoma -1.100 0.038
ulcerative colitis -1.100 0.000
psoriasis -1.100 0.000

 GO Function (2)

Gene RIF (27)

PMID Text
27215085 MMP9 and PIWIL2 expression levels in cancerous tissues were significantly higher than the adjacent normal tissues
26775345 Knockdown of Piwil2 gene in SiHa cells inhibited cell growth and invasion, and downregulated matrix metalloproteinase-9 (MMP-9) compared to scrambled shRNA transfected cells
26373553 PIWIL2 has a role in promoting progression of non-small cell lung cancer by inducing CDK2 and Cyclin A expression
26125915 Univariate analysis demonstrated that high PIWIL2 expression was associated with shorter survival time after radical resection.
26026091 Our results indicate a reciprocal regulation between HIWI, HILI and some CSCs markers in colorectal cancer
25998509 Piwil 2 expression is correlated with disease-specific and progression-free survival of chemotherapy-treated bladder cancer patients
25384072 Results show that both PIWIL2 protein isoforms are expressed in testicular germ cell lines but in the tumors, the short protein and mRNA are predominant and highly expressed in undifferentiated tumors.
25193865 PIWIL2 modulates tumor cell proliferation and F-actin filaments by interacting with NME2 and regulating c-Myc expression.
25113562 Study indicates that Piwil2 plays a role in Fas-mediated apoptosis and can affect p53 phosphorylation in tumor cells, revealing a novel mechanism of Piwil2 in apoptosis, and supports that Piwil2 plays an active role in tumorigenesis.
25040173 This study revealed critical negative regulation of TGF-beta signalling by PIWIL2 in HepG2 tumour cells.
More...

AA Sequence

MDPFRPSFRGQSPIHPSQCQAVRMPGCWPQASKPLDPALGRGAPAGRGHVFGKPEEPSTQRGPAQRESVG      1 - 70
LVSMFRGLGIETVSKTPLKREMLPSGRGILGRGLSANLVRKDREELSPTFWDPKVLAAGDSKMAETSVGW     71 - 140
SRTLGRGSSDASLLPLGRAAGGISREVDKPPCTFSTPSRGPPQLSSPPALPQSPLHSPDRPLVLTVEHKE    141 - 210
KELIVKQGSKGTPQSLGLNLVKIQCHNEAVYQYHVTFSPNVECKSMRFGMLKDHQAVTGNVTAFDGSILY    211 - 280
LPVKLQQVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAM    281 - 350
VLQQHRLQIWPGYAASIRRTDGGLFLLADVSHKVIRNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVIT    351 - 420
RYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNHGMLLKGE    421 - 490
ILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIAKNEAATNELMRWGLRLQKDV    491 - 560
HKIEGRVLPMERINLKNTSFITSQELNWVKEVTRDPSILTIPMHFWALFYPKRAMDQARELVNMLEKIAG    561 - 630
PIGMRMSPPAWVELKDDRIETYVRTIQSTLGAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVN    631 - 700
VRTIGQPTRLRSVAQKILLQINCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTK    701 - 770
WYSRVVFQMPHQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAF    771 - 840
ENYQPKMVVFVVQKKISTNLYLAAPQNFVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYVCVL    841 - 910
NTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHHEPAIQLCENLFFL           911 - 973
//

Text Mined References (36)

PMID Year Title
27215085 2016 Expression Levels of MMP9 and PIWIL2 in Prostate Cancer: a Case-Control Study.
26775345 2015 HPV 16 infection up-regulates Piwil2, which affects cell proliferation and invasion in cervical cancer by regulating MMP-9 via the MAPK pathway.
26373553 2015 PIWIL2 promotes progression of non-small cell lung cancer by inducing CDK2 and Cyclin A expression.
26125915 2015 Expression and clinical significance of PIWIL2 in hilar cholangiocarcinoma tissues and cell lines.
26026091 2015 Correlation of HIWI and HILI Expression with Cancer Stem Cell Markers in Colorectal Cancer.
25998509 2015 Piwil 2 expression is correlated with disease-specific and progression-free survival of chemotherapy-treated bladder cancer patients.
25384072 2014 Expression profiles of PIWIL2 short isoforms differ in testicular germ cell tumors of various differentiation subtypes.
25193865 2014 PIWIL2 induces c-Myc expression by interacting with NME2 and regulates c-Myc-mediated tumor cell proliferation.
25113562 2014 Piwil2 inhibits keratin 8 degradation through promoting p38-induced phosphorylation to resist Fas-mediated apoptosis.
25040173 2014 A TALEN-based specific transcript knock-down of PIWIL2 suppresses cell growth in HepG2 tumor cell.
More...