Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.53
PubTator Score 2.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.0e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 37 3.724 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.948 1.0e-06

Synonym

Accession Q8TC57 B7Z6E7 E9PGG8 Q6ZP30 Q96L07
Symbols D6Mm5e
C2orf65
SPATA37

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MHPGRTTGKGPSTHTQIDQQPPRLLIVHIALPSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQ      1 - 70
DQHECILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSRHVTTRAALTYTS     71 - 140
LEITILTSQPGKEVVKQLEEGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDLQ    141 - 210
TIDNDIVSMEIFFKAWLHNSGTDQEQIHLLLSSQCFSNISRPRDNPMCLKCDLQERLLCPSLLAGTADGS    211 - 280
LRMDDPKGDFITLYQMASQSSASHYKLQVIKALKSSGLCESLTYGLPFILRPTSCWQLDWDELETNQQHF    281 - 350
HALCHSLLKREWLLLAKGEPPGPGHSQRIPASTFYVIMPSHSLTLLVKAVATRELMLPSTFPLLPEDPHD    351 - 420
DSLKNVESMLDSLELEPTYNPLHVQSHLYSHLSSIYAKPQGRLHPHWESRAPRKHPCKTGQLQTNRARAT    421 - 490
VAPLPMTPVPGRASKMPAASKSSSDAFFLPSEWEKDPSRP                                  491 - 530
//

Text Mined References (11)

PMID Year Title