Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.29
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Synonym

Accession Q8TC56 Q1EDD9 Q8TC64 Q96LY8
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MSNESCLPYYTAHSYSSMSAFKTSMGDLQRQLYNRGEYNIFKYAPMFESNFIQINKKGEVIDVHNRVRMV      1 - 70
TVGIVCTSPILPLPDVMVLAQPTKICEQHVRWGRFAKGRGRRPVKTLELTRLLPLKFVKISIHDHEKQQL     71 - 140
RLKLATGRTFYLQLCPSSDTREDLFCYWEKLVYLLRPPVESYCSTPTLLSGDAPPEDNKSLVAAELHREG    141 - 210
DQSETGLYKPCDVSAATSSAYAGGEGIQHASHGTASAASPSTSTPGAAEGGAARTAGGMAVAGTATGPRT    211 - 280
DVAIAGAAMSPATGAMSIATTKSAGPGQVTTALAGAAIKNPGENESSKSMAGAANISSEGISLALVGAAS    281 - 350
TSLEGTSTSMAGAASLSQDSSLSAAFAGSITTSKCAAERTEGPAVGPLISTLQSEGYMSERDGSQKVSQP    351 - 420
SAEVWNENKERREKKDRHPSRKSSHHRKAGESHRRRAGDKNQKASSHRSASGHKNTRDDKKEKGYSNVRG    421 - 490
KRHGSSRKSSTHSSTKKESRTTQELGKNQSASSTGALQKKASKISSFLRSLRATPGSKTRVTSHDREVDI    491 - 560
VAKMVEKQNIEAKVEKAQGGQELEMISGTMTSEKTEMIVFETKSI                             561 - 605
//

Text Mined References (6)

PMID Year Title