Property Summary

NCBI Gene PubMed Count 6
Grant Count 7
R01 Count 5
Funding $1,624,485
PubMed Score 0.68
PubTator Score 1.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
pancreatic cancer 1.100 0.000
astrocytic glioma 1.100 0.008
posterior fossa group B ependymoma 3.100 0.000
group 3 medulloblastoma -1.500 0.005
lung adenocarcinoma -1.400 0.000
pancreatic carcinoma 1.100 0.000
nasopharyngeal carcinoma -1.600 0.000
psoriasis 4.800 0.000

Gene RIF (1)

PMID Text
15385169 Data suggest that enkurin is an adaptor that functions to localize a Ca2+ sensitive signal transduction machinery in sperm to a Ca2+-permeable ion channel [enkurin]

AA Sequence

MDPTCSSECIYNLIPSDLKEPPQPPRYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEK      1 - 70
TLPPKKNFDRNVPKKPAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSG     71 - 140
LVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKE    141 - 210
FQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKIIYIANNA                            211 - 256
//

Text Mined References (6)

PMID Year Title
17217053 2007 Canonical transient receptor potential 5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385169 2004 Enkurin is a novel calmodulin and TRPC channel binding protein in sperm.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.