Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.22
PubTator Score 6.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession Q8TC26 Q53QM3 Q53SV7 Q69YH3 Q9UFG3
Symbols DC29
SV31

Gene

 GO Function (1)

Gene RIF (3)

PMID Text
25130899 TMEM163 is a putative zinc transporter, a novel interacting partner for TRPML1, essential for zinc homeostasis.
23209189 Data suggest that SNP within TMEM163 (rs998451) and SNP near TMEM163 (rs6723108) are associated with type 2 diabetes and insulin resistance in subjects in India (versus Indo-Europeans and Dravidians). [META-ANALYSIS; Genome-Wide Association Studies]
18187620 Knockdown of transmembrane protein 163 (TMEM163) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MEPAAGIQRRSSQGPTVPPPPRGHAPPAAAPGPAPLSSPVREPPQLEEERQVRISESGQFSDGLEDRGLL      1 - 70
ESSTRLKPHEAQNYRKKALWVSWFSIIVTLALAVAAFTVSVMRYSASAFGFAFDAILDVLSSAIVLWRYS     71 - 140
NAAAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSVSILSGILCSILAVLKFML    141 - 210
GKVLTSRALITDGFNSLVGGVMGFSILLSAEVFKHDSAVWYLDGSIGVLIGLTIFAYGVKLLIDMVPRVR    211 - 280
QTRHYEMFE                                                                 281 - 289
//

Text Mined References (10)

PMID Year Title
25130899 2014 Cellular zinc levels are modulated by TRPML1-TMEM163 interaction.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23209189 2013 Genome-wide association study for type 2 diabetes in Indians identifies a new susceptibility locus at 2q21.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17623043 2007 Identification and characterization of SV31, a novel synaptic vesicle membrane protein and potential transporter.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.