Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.46
PubTator Score 6.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active ulcerative colitis 1.283 1.8e-02
acute myeloid leukemia -1.500 3.1e-02
adult high grade glioma -1.300 1.8e-03
atypical teratoid / rhabdoid tumor -2.000 1.5e-03
glioblastoma -1.200 3.3e-02
group 3 medulloblastoma -2.700 1.2e-05
medulloblastoma, large-cell -1.600 7.5e-03
non-small cell lung cancer -1.548 3.7e-11
ovarian cancer -1.300 2.3e-04
Pick disease -1.100 1.8e-02
pituitary cancer -3.100 2.8e-08
posterior fossa group A ependymoma 1.300 2.3e-09
psoriasis 1.200 8.3e-21
subependymal giant cell astrocytoma -2.286 8.9e-03
tuberculosis -1.300 1.1e-04

 GO Function (1)

Gene RIF (4)

AA Sequence

MEPAAGIQRRSSQGPTVPPPPRGHAPPAAAPGPAPLSSPVREPPQLEEERQVRISESGQFSDGLEDRGLL      1 - 70
ESSTRLKPHEAQNYRKKALWVSWFSIIVTLALAVAAFTVSVMRYSASAFGFAFDAILDVLSSAIVLWRYS     71 - 140
NAAAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSVSILSGILCSILAVLKFML    141 - 210
GKVLTSRALITDGFNSLVGGVMGFSILLSAEVFKHDSAVWYLDGSIGVLIGLTIFAYGVKLLIDMVPRVR    211 - 280
QTRHYEMFE                                                                 281 - 289
//

Text Mined References (11)

PMID Year Title