Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.03
PubTator Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 6.7e-18
group 3 medulloblastoma 4104 1.5e-04
osteosarcoma 7950 9.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.400 1.5e-04
lung carcinoma 1.100 6.7e-18
osteosarcoma -1.126 9.1e-03

AA Sequence

MPSPDSMTFEDIIVDFTQEEWALLDTSQRKLFQDVMLENISHLVSIGKQLCKSVVLSQLEQVEKLSTQRI      1 - 70
SLLQGREVGIKHQEIPFIQHIYQKGTSTISTMRSHTQEDPFLCNDLGEDFTQHIALTQNVITYMRTKHFV     71 - 140
SKKFGKIFSDWLSFNQHKEIHTKCKSYGSHLFDYAFIQNSALRPHSVTHTREITLECRVCGKTFSKNSNL    141 - 210
RRHEMIHTGEKPHGCHLCGKAFTHCSDLRKHERTHTGEKPYGCHLCGKAFSKSSNLRRHEMIHTREKAQI    211 - 280
CHLCGKAFTHCSDLRKHERTHLGDKPYGCLLCGKAFSKCSYLRQHERTHNGEKPYECHLCGKAFSHCSHL    281 - 350
RQHERSHNGEKPHGCHLCGKAFTESSVLKRHERIHTGEKPYECHVCGKAFTESSDLRRHERTHTGEKPYE    351 - 420
CHLCGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVHTGEKPYVCPLCGKAFSKFFNL    421 - 490
RQHERTHTKKAMNM                                                            491 - 504
//

Text Mined References (5)

PMID Year Title