Property Summary

NCBI Gene PubMed Count 10
Grant Count 10
R01 Count 5
Funding $563,881.5
PubMed Score 509.04
PubTator Score 206.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 4.884 2.4

Expression

Gene RIF (5)

PMID Text
24174534 CAGE and miR-200b form a feedback regulatory loop.
17786288 The present data suggest that promoter methylation of the 14-3-3 sigma and CAGE-1 genes plays a crucial role during the phenotypical morphogenesis of vesical adenocarcinomas including signet ring cell carcinomas by an epigenetic mechanism.
17114284 CTSP-1 should be considered a promising candidate for cancer immunotherapy
16964403 The different patterns of aberrant methylation of the CAGE-1 gene in the various histopathological cancer types of the urinary bladder point to a role in tumor cell differentiation.
12531476 identification and characterization of CAGE-1 gene; displays testis-specific expression among normal tissues, and wide expression among various cancer tissues and cancer cell lines

AA Sequence

MNKDYQKFWSSPSDPVHFEVDTSHEKVESMSESDTMNVSNLSQGVMLSHSPICMETTGTTCDLPQNEIKN      1 - 70
FERENEYESTLCEDAYGTLDNLLNDNNIENYSTNALIQPVDTISISSLRQFETVCKFHWVEAFDDEMTEK     71 - 140
PEFQSQVYNYAKDNNIKQDSFKEENPMETSVSANTDQLGNEYFRQPPPRSPPLIHCSGEMLKFTEKSLAK    141 - 210
SIAKESALNPSQPPSFLCKTAVPSKEIQNYGEIPEMSVSYEKEVTAEGVERPEIVSTWSSAGISWRSEAC    211 - 280
RENCEMPDWEQSAESLQPVQEDMALNEVLQKLKHTNRKQEVRIQELQCSNLYLEKRVKELQMKITKQQVF    281 - 350
IDVINKLKENVEELIEDKYKIILEKNDTKKTLQNLEEVLANTQKHLQESRNDKEMLQLQFKKIKANYVCL    351 - 420
QERYMTEMQQKNKSVSQYLEMDKTLSKKEEEVERLQQLKKELEKATASALDLLKREKEAQEQEFLSLQEE    421 - 490
FQKLEKENLEERQKLKSRLEKLLTQVRNLQFMSENERTKNIKLQQQINEVKNENAKLKQQVARSEEQNYV    491 - 560
PKFETAQLKDQLEEVLKSDITKDTKTTHSNLLPDCSPCEERLNPADIKRASQLASKMHSLLALMVGLLTC    561 - 630
QDIINSDAEHFKESEKVSDIMLQKLKSLHLKKKTLDKEVIDCDSDEAKSIRDVPTLLGAKLDKYHSLNEE    631 - 700
LDFLVTSYEEIIECADQRLAISHSQIAHLEERNKHLEDLIRKPREKARKPRSKSLENHPKSMTMMPALFK    701 - 770
ENRNDLD                                                                   771 - 777
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24174534 2013 miR-200b and cancer/testis antigen CAGE form a feedback loop to regulate the invasion and tumorigenic and angiogenic responses of a cancer cell line to microtubule-targeting drugs.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17786288 2007 High frequency of promoter methylation of the 14-3-3 sigma and CAGE-1 genes, but lack of hypermethylation of the caveolin-1 gene, in primary adenocarcinomas and signet ring cell carcinomas of the urinary bladder.
17114284 2006 Characterization of a cancer/testis (CT) antigen gene family capable of eliciting humoral response in cancer patients.
16964403 2006 Promoter hypermethylation of the 14-3-3 sigma, SYK and CAGE-1 genes is related to the various phenotypes of urinary bladder carcinomas and associated with progression of transitional cell carcinomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12531476 2003 Identification and characterization of a novel cancer/testis antigen gene CAGE-1.
More...