Property Summary

NCBI Gene PubMed Count 22
PubMed Score 1370.12
PubTator Score 18.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.547 4.4e-03
active ulcerative colitis 1.273 1.3e-02
ductal carcinoma in situ 1.100 1.2e-04
lung cancer 1.100 1.3e-02
lung carcinoma 1.100 4.2e-18
medulloblastoma, large-cell -1.200 1.1e-05
Multiple myeloma 1.119 5.4e-03
osteosarcoma 1.150 1.3e-03
pancreatic ductal adenocarcinoma liver m... -1.547 1.1e-03

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (8)

AA Sequence

MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYL      1 - 70
ACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTAD     71 - 140
GFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANI    141 - 210
LFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILS    211 - 280
GNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID                                    281 - 318
//

Text Mined References (27)

PMID Year Title