Property Summary

NCBI Gene PubMed Count 22
Grant Count 52
R01 Count 33
Funding $5,593,232.32
PubMed Score 1314.80
PubTator Score 18.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.119 0.005
osteosarcoma 1.150 0.001
medulloblastoma, large-cell -1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.681 0.001
lung cancer 1.600 0.001
active Crohn's disease 1.788 0.007
active ulcerative colitis 1.286 0.017
lung carcinoma 1.100 0.000
ductal carcinoma in situ 1.100 0.000

Gene RIF (8)

PMID Text
25829192 Data indicate that ribosomal protein L11 (RPL11)-expressing cells proliferated more rapidly than the ribosomal protein L11 (RPL11)-expressing cells.
25542782 Data suggest that membrane anchoring of retinol dehydrogenase 11 (RDH11) is likely driven by its N-terminal segment.
24916380 deleterious mutations in RDH11, an important enzyme for vision-related and systemic retinoic acid metabolism, cause a new syndrome with RP.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of retinol dehydrogenase 11 (RDH11) expression by HIV-1 Vpr in Vpr transduced macrophages
17249616 RDH11 localizes to photoreceptor inner segments [review]
14674758 Expression pattern and high catalytic efficiency of RalR1 are consistent with the hypothesis that RalR1 contributes to the reduction of retinal in various human tissues.
12532453 The core protein of HCV can interact with translin protein. This can partly explain the molecular mechanism for hepatocellular carcinoma and lymphoma caused by HCV.
12036956 Prostate short-chain dehydrogenase/reductase (PSDR1) encodes a novel retinal reductase (RalR1).

AA Sequence

MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYL      1 - 70
ACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTAD     71 - 140
GFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANI    141 - 210
LFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILS    211 - 280
GNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID                                    281 - 318
//

Text Mined References (27)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25829192 2015 Ribosomal protein L11- and retinol dehydrogenase 11-induced erythroid proliferation without erythropoietin in UT-7/Epo erythroleukemic cells.
25542782 2015 Structure of the N-terminal segment of human retinol dehydrogenase 11 and its preferential lipid binding using model membranes.
24916380 2014 New syndrome with retinitis pigmentosa is caused by nonsense mutations in retinol dehydrogenase RDH11.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18295589 2008 In vitro and in vivo characterization of retinoid synthesis from beta-carotene.
More...