Property Summary

NCBI Gene PubMed Count 21
PubMed Score 5.07
PubTator Score 4.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.201 3.6e-08
atypical teratoid / rhabdoid tumor -1.600 3.1e-05
glioblastoma -1.400 1.3e-03
malignant mesothelioma 1.100 1.1e-05
medulloblastoma, large-cell -1.300 1.3e-03
osteosarcoma -2.910 2.6e-06
ovarian cancer -1.100 1.8e-04

Gene RIF (6)

AA Sequence

MAAAGVVSGKIIYEQEGVYIHSSCGKTNDQDGLISGILRVLEKDAEVIVDWRPLDDALDSSSILYARKDS      1 - 70
SSVVEWTQAPKERGHRGSEHLNSYEAEWDMVNTVSFKRKPHTNGDAPSHRNGKSKWSFLFSLTDLKSIKQ     71 - 140
NKEGMGWSYLVFCLKDDVVLPALHFHQGDSKLLIESLEKYVVLCESPQDKRTLLVNCQNKSLSQSFENLL    141 - 210
DEPAYGLIQAGLLDRRKLLWAIHHWKKIKKDPYTATMIGFSKVTNYIFDSLRGSDPSTHQRPPSEMADFL    211 - 280
SDAIPGLKINQQEEPGFEVITRIDLGERPVVQRREPVSLEEWTKNIDSEGRILNVDNMKQMIFRGGLSHA    281 - 350
LRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSISQEQEKRNSRLRDYRSLIEKDVNRTDR    351 - 420
TNKFYEGQDNPGLILLHDILMTYCMYDFDLGYVQGMSDLLSPLLYVMENEVDAFWCFASYMDQMHQNFEE    421 - 490
QMQGMKTQLIQLSTLLRLLDSGFCSYLESQDSGYLYFCFRWLLIRFKREFSFLDILRLWEVMWTELPCTN    491 - 560
FHLLLCCAILESEKQQIMEKHYGFNEILKHINELSMKIDVEDILCKAEAISLQMVKCKELPQAVCEILGL    561 - 630
QGSEVTTPDSDVGEDENVVMTPCPTSAFQSNALPTLSASGARNDSPTQIPVSSDVCRLTPA             631 - 691
//

Text Mined References (31)

PMID Year Title