Property Summary

NCBI Gene PubMed Count 9
PubMed Score 12.16
PubTator Score 9.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
posterior fossa group B ependymoma 416 1.4e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
diabetes mellitus 1728 0.0 4.0
Disease Target Count Z-score Confidence
Microcephaly 166 4.05 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.500 1.4e-05

Gene RIF (4)

AA Sequence

MSSEMLPAFIETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQRELRKQKRKEKRK      1 - 70
RKKLERQCQMEPNSDGHDRKRVRRDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQ     71 - 140
FYLTSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAYVIGGLVD    141 - 210
HNHHKGLTYKQASDYGINHAQLPLGNFVKMNSRKVLAVNHVFEIILEYLETRDWQEAFFTILPQRKGAVP    211 - 280
TDKACESASHDNQSVRMEEGGSDSDSSEEEYSRNELDSPHEEKQDKENHTESTVNSLPH               281 - 339
//

Text Mined References (14)

PMID Year Title