Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.30
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.600 2.2e-11
group 3 medulloblastoma 1.700 1.5e-03
intraductal papillary-mucinous neoplasm ... -1.400 1.1e-02
mucosa-associated lymphoid tissue lympho... -1.076 7.8e-03
osteosarcoma -1.282 4.0e-04

Gene RIF (1)

AA Sequence

MLNMQGAEERDIRRETCPGWVNKNKPALEQDVCKIDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPR      1 - 70
EIAESCLFQEGGFGRITFIHKEAPPEIISQGYNFEKSLLLTSSLVTRLRVSTEESLHQWETSNIQTNDIS     71 - 140
DQSKCPTLCTQKKSWKCNECGKTFTQSSSLTQHQRTHTGERPYTCEECGKAFSRSSFLVQHQRIHTGVKP    141 - 210
YGCEQCGKTFRCRSFLTQHQRIHTGEKPYKCNECGNSFRNHSHLTEHQRIHTGEKPYKCNRCGKAFNQNT    211 - 280
HLIHHQRIHTGEKPYICSECGSSFRKHSNLTQHQRIHTGEKPHKCDECGKTFQTKANLSQHQRIHSGEKP    281 - 350
YKCKECGKAFCQSPSLIKHQRIHTGEKPYKCKECGKAFTQSTPLTKHQRIHTGERPYKCSECGKAFIQSI    351 - 420
CLIRHQRSHTGEKPYKCNECGKGFNQNTCLTQHMRIHTGEKPYKCKECGKAFAHSSSLTEHHRTHTGEKL    421 - 490
YKCSECEKTFRKYAHLSEHYRIHTGEKPYECIECGKFFRHSSVLFRHQKLHSGD                    491 - 544
//

Text Mined References (7)

PMID Year Title