Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.17
PubTator Score 3.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.300 0.007
ependymoma -1.100 0.027
oligodendroglioma -1.100 0.017
glioblastoma -1.100 0.002
medulloblastoma -1.200 0.001
intraductal papillary-mucinous adenoma (... -3.100 0.000
intraductal papillary-mucinous carcinoma... -3.200 0.000
intraductal papillary-mucinous neoplasm ... -2.900 0.005
pancreatic cancer -1.700 0.001
pituitary cancer -1.200 0.003
psoriasis -1.100 0.000

Synonym

Accession Q8TBZ0 Q86YI9 Q8N7W0
Symbols CT52
KMHN1
KM-HN-1

Gene

Gene RIF (1)

PMID Text
15447989 KM-HN-1 is a novel human cancer/testis antigen recognized by cellular and humoral immune responses

AA Sequence

MSPEKQHREEDEVDSVLLSASKILNSSEGVKESGCSDTEYGCIAESENQIQPQSALKVLQQQLESFQALR      1 - 70
MQTLQNVSMVQSEISEILNKSIIEVENPQFSSEKNLVFGTRIEKDLPTENQEENLSMEKSHHFEDSKTLH     71 - 140
SVEEKLSGDSVNSLPQSVNVPSQIHSEDTLTLRTSTDNLSSNIIIHPSENSDILKNYNNFYRFLPTAPPN    141 - 210
VMSQADTVILDKSKITVPFLKHGFCENLDDICHSIKQMKEELQKSHDGEVALTNELQTLQTDPDVHRNGK    211 - 280
YDMSPIHQDKMNFIKEENLDGNLNEDIKSKRISELEALVKKLLPFRETVSKFHVHFCRKCKKLSKSEMHR    281 - 350
GKKNEKNNKEIPITGKNITDLKFHSRVPRYTLSFLDQTKHEMKDKERQPFLVKQGSIISENEKTSKVNSV    351 - 420
TEQCVAKIQYLQNYLKESVQIQKKVMELESENLNLKSKMKPLIFTTQSLIQKVETYEKQLKNLVEEKSTI    421 - 490
QSKLSKTEEYSKECLKEFKKIISKYNVLQGQNKTLEEKNIQLSLEKQQMMEALDQLKSKEHKTQSDMAIV    491 - 560
NNENNRMSIEMEAMKTNILLIQDEKEMLEKKTHQLLKEKSSLGNELKESQLEIIQLKEKERLAKTEQETL    561 - 630
LQIIETVKDEKLNLETTLQESTAARQIMEREIENIQTYQSTAEENFLQEIKNAKSEASIYKNSLSEIGKE    631 - 700
CEMLSKMVMETKTDNQILKEELKKHSQENIKFENSISRLTEDKILLENYVRSIENERDTLEFEMRHLQRE    701 - 770
YLSLSDKICNQHNDPSKTTYISRREKFHFDNYTHEDTSSPQSRPLASDLKGYFKVKDRTLKHH           771 - 833
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18160854 2007 The centrosomal localization of KM-HN-1 (MGC33607) depends on the leucine zipper motif and the C-terminal coiled-coil domain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15447989 2004 Identification of a novel human cancer/testis antigen, KM-HN-1, recognized by cellular and humoral immune responses.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.