Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.56
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
chronic rhinosinusitis -1.938 3.5e-02
cystic fibrosis 2.100 1.3e-04
ependymoma 2.000 9.8e-10
lung adenocarcinoma 1.900 1.3e-03
nasopharyngeal carcinoma -1.600 9.5e-08
non-small cell lung cancer 3.072 1.6e-14
osteosarcoma -1.502 2.4e-03
pituitary cancer -1.500 1.4e-05
psoriasis 2.400 1.0e-24

Gene RIF (5)

AA Sequence

MSDAAEAPREATGENGETEMKEEEEPNPNYKEVEDPQQESKDDTIAWRESQEEERKTGEEEGEEEGKEDK      1 - 70
KIVMEETEEKAGEVQEKEASGIQEETTVEPQEVTASMIRLETQITDSQSITSGIFPKTQRGSKSKLSLQL     71 - 140
EDAETDELLRDLSTQIEFLDLDQISPEEQQISSPERQPSGELEEKTDRMPQDELGQERRDLEPENREEGQ    141 - 210
ERRVSDIQSKAGISRESLVSSTTEDILFQKDKSTPVYPLTMTWSFGWNSSLPVYYIREERQRVLLYVCAH    211 - 280
TAIIYNVFRNNQYHLQGHANIISCLCVSEDRRWIATADKGPDCLVIIWDSFTGIPVHTIFDSCPEGNGIM    281 - 350
AMAMTHDAKYLATISDAEVQKVCIWKWTLAVETPACTLELPTEYGVQNYVTFNPTNNKELVSNSKTRAIY    351 - 420
YAWYEERDTLAHSAPLLTEKTFNKLVGKFSQSIFHLNLTQILSATMEGKLVVWDIHRPPSSASTFLGFPY    421 - 490
IKPCKLVHLQKEGITVLTTIDSYIVTGDIKGNIKFYDHTLSIVNWYSHLKLGAIRTLSFSKTPATPPTEK    491 - 560
SNYPPDCTLKGDLFVLRNFIIGTSDAAVYHLTTDGTKLEKLFVEPKDAICAISCHPYQPLIAIGSICGMI    561 - 630
KVWNYENKQYLFSRVFEKGLGVQSLTYNPEGALLGAGFTEGTVYILDAMSLENESPEPFKYSRTSVTHIS    631 - 700
FSHDSQYMATADRSFTVAVYMLVVRNGQRVWEYLARLRSHRKSIRSLLFGVYLDSNEPRLLSLGTDRLLI    701 - 770
EYDLLRSYKDHLEVLDIHHTDQGCYPTCMVWYPPLTRELFLLICNSGYKVKLFNATTKMCRKTLLGPAYG    771 - 840
SPIEQTQVLPVRSMAELQKRYLVFINRDKVGLQILPVDGNPHKTSAIVCHPNGVAGMAVSYDGCYAFTAG    841 - 910
GHDRSVVQWKITLSVLEAAVSLGGEDLTPFYGLLSGGREGKFYRELEDYFYYSQLRSQGIDTMETRKVSE    911 - 980
HICLSELPFVMRAIGFYPSEEKIDDIFNEIKFGEYVDTGKLIDKINLPDFLKVYLNHKPPFGNTMSGIHK    981 - 1050
SFEVLGYTNSKGKKAIRREDFLRLLVTKGEHMTEEEMLDCFASLFGLNPEGWKSEPATCSVKGSEICLEE   1051 - 1120
ELPDEITAEIFATEILGLTISEDSGQDGQ                                            1121 - 1149
//

Text Mined References (20)

PMID Year Title