Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.56
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.502 0.002
posterior fossa group B ependymoma 3.200 0.000
non-small cell lung cancer 3.072 0.000
cystic fibrosis 2.600 0.000
psoriasis 2.500 0.000
lung adenocarcinoma 1.900 0.001
nasopharyngeal carcinoma -1.800 0.000
pituitary cancer -1.800 0.000
chronic rhinosinusitis -1.938 0.035

Gene RIF (5)

PMID Text
23514407 WDR66 expression is likely to play an important role in esophageal squamous cell carcinoma growth and invasion as a positive modulator of epithelial-mesenchymal transition.
22552337 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
21572414 Indicates that an intronic SNP in the WDR66 gene associates with 2-hydroxyisobutyrate concentrations.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19110211 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSDAAEAPREATGENGETEMKEEEEPNPNYKEVEDPQQESKDDTIAWRESQEEERKTGEEEGEEEGKEDK      1 - 70
KIVMEETEEKAGEVQEKEASGIQEETTVEPQEVTASMIRLETQITDSQSITSGIFPKTQRGSKSKLSLQL     71 - 140
EDAETDELLRDLSTQIEFLDLDQISPEEQQISSPERQPSGELEEKTDRMPQDELGQERRDLEPENREEGQ    141 - 210
ERRVSDIQSKAGISRESLVSSTTEDILFQKDKSTPVYPLTMTWSFGWNSSLPVYYIREERQRVLLYVCAH    211 - 280
TAIIYNVFRNNQYHLQGHANIISCLCVSEDRRWIATADKGPDCLVIIWDSFTGIPVHTIFDSCPEGNGIM    281 - 350
AMAMTHDAKYLATISDAEVQKVCIWKWTLAVETPACTLELPTEYGVQNYVTFNPTNNKELVSNSKTRAIY    351 - 420
YAWYEERDTLAHSAPLLTEKTFNKLVGKFSQSIFHLNLTQILSATMEGKLVVWDIHRPPSSASTFLGFPY    421 - 490
IKPCKLVHLQKEGITVLTTIDSYIVTGDIKGNIKFYDHTLSIVNWYSHLKLGAIRTLSFSKTPATPPTEK    491 - 560
SNYPPDCTLKGDLFVLRNFIIGTSDAAVYHLTTDGTKLEKLFVEPKDAICAISCHPYQPLIAIGSICGMI    561 - 630
KVWNYENKQYLFSRVFEKGLGVQSLTYNPEGALLGAGFTEGTVYILDAMSLENESPEPFKYSRTSVTHIS    631 - 700
FSHDSQYMATADRSFTVAVYMLVVRNGQRVWEYLARLRSHRKSIRSLLFGVYLDSNEPRLLSLGTDRLLI    701 - 770
EYDLLRSYKDHLEVLDIHHTDQGCYPTCMVWYPPLTRELFLLICNSGYKVKLFNATTKMCRKTLLGPAYG    771 - 840
SPIEQTQVLPVRSMAELQKRYLVFINRDKVGLQILPVDGNPHKTSAIVCHPNGVAGMAVSYDGCYAFTAG    841 - 910
GHDRSVVQWKITLSVLEAAVSLGGEDLTPFYGLLSGGREGKFYRELEDYFYYSQLRSQGIDTMETRKVSE    911 - 980
HICLSELPFVMRAIGFYPSEEKIDDIFNEIKFGEYVDTGKLIDKINLPDFLKVYLNHKPPFGNTMSGIHK    981 - 1050
SFEVLGYTNSKGKKAIRREDFLRLLVTKGEHMTEEEMLDCFASLFGLNPEGWKSEPATCSVKGSEICLEE   1051 - 1120
ELPDEITAEIFATEILGLTISEDSGQDGQ                                            1121 - 1149
//

Text Mined References (20)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23514407 2013 Wdr66 is a novel marker for risk stratification and involved in epithelial-mesenchymal transition of esophageal squamous cell carcinoma.
22552337 2012 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21572414 2011 A genome-wide association study of metabolic traits in human urine.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19110211 2009 A genome-wide association study identifies three loci associated with mean platelet volume.
18925368 2008 Diversity of WD-repeat proteins.
More...