Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.41
PubTator Score 31.31

Knowledge Summary

Patent (989)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.77923281446267E-7
psoriasis 6685 3.73987713333346E-5
medulloblastoma, large-cell 6234 3.91287100118515E-5
glioblastoma 5572 5.31404318155389E-5
medulloblastoma 1524 6.91250552430345E-5
pituitary cancer 1972 1.81535561264249E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.51515199589873E-4
invasive ductal carcinoma 2950 0.00303637692613212
astrocytic glioma 2241 0.00314083694226332
primitive neuroectodermal tumor 3031 0.00434482518657972
osteosarcoma 7933 0.00937684201818916
ependymoma 2514 0.0112451690700304
oligodendroglioma 2849 0.019291333434687
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 3.267 1.6

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.800 0.003
ependymoma -1.800 0.011
oligodendroglioma -1.500 0.019
psoriasis -2.500 0.000
osteosarcoma -1.281 0.009
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.300 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.100 0.004
intraductal papillary-mucinous neoplasm ... 1.400 0.000
invasive ductal carcinoma 1.100 0.003
pituitary cancer 1.200 0.000

Synonym

Accession Q8TBX8 B2RDL3 B4DM11 B4DY44 Q9H6N2
Symbols PIP5K2C

Gene

PANTHER Protein Class (2)

PDB

2GK9  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

Gene RIF (3)

PMID Text
20439292 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19644859 Observational study of gene-disease association. (HuGE Navigator)
18794853 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVM      1 - 70
LLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGR     71 - 140
FLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHR    141 - 210
LPVHRKYDLKGSLVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMD    211 - 280
YSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESF    281 - 350
IDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF    351 - 420
A//

Text Mined References (21)

PMID Year Title
25578879 2015 PI(5)P regulates autophagosome biogenesis.
25495341 2015 The function of phosphatidylinositol 5-phosphate 4-kinase ? (PI5P4K?) explored using a specific inhibitor that targets the PI5P-binding site.
23758345 2013 Evolutionarily conserved structural changes in phosphatidylinositol 5-phosphate 4-kinase (PI5P4K) isoforms are responsible for differences in enzyme activity and localization.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20439292 2010 Genetic variants in the prediction of rheumatoid arthritis.
19644859 2009 Association of a single-nucleotide polymorphism in CD40 with the rate of joint destruction in rheumatoid arthritis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18794853 2008 Common variants at CD40 and other loci confer risk of rheumatoid arthritis.
More...