Property Summary

Ligand Count 1
NCBI Gene PubMed Count 15
PubMed Score 2.41
PubTator Score 31.31

Knowledge Summary

Patent (989)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.800 3.1e-03
atypical teratoid / rhabdoid tumor -1.500 2.8e-07
ependymoma -1.800 1.1e-02
glioblastoma -1.300 5.3e-05
intraductal papillary-mucinous neoplasm ... 1.400 3.5e-04
invasive ductal carcinoma 1.100 3.0e-03
medulloblastoma -1.400 6.9e-05
medulloblastoma, large-cell -1.900 3.9e-05
oligodendroglioma -1.500 1.9e-02
osteosarcoma -1.281 9.4e-03
pituitary cancer 1.200 1.8e-04
primitive neuroectodermal tumor -1.100 4.3e-03
psoriasis -2.500 3.7e-05

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVM      1 - 70
LLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGR     71 - 140
FLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHR    141 - 210
LPVHRKYDLKGSLVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMD    211 - 280
YSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESF    281 - 350
IDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF    351 - 420
A//

Text Mined References (21)

PMID Year Title