Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $225,000
PubMed Score 11.76
PubTator Score 7.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
20024628 The researchers found evidence that CT120 may be a key factor in tumor progression and that down-regulation of CT120 may be an effective treatment for lung neoplasms.
16143812 CT120B overexpression resulted in reduction of cell growth rate & inhibited tumorigenecity & anchorage-independent growth; findings suggest that the delayed G1/S phase transition might contribute to the inhibitory activities of CT120B on cell growth
12270127 Molecular cloning and characterization of this novel membrane-associated gene involved in amino acid transport and glutathione metabolism

AA Sequence

MLLTLAGGALFFPGLFALCTWALRRSQPGWSRTDCVMISTRLVSSVHAVLATGSGIVIIRSCDDVITGRH      1 - 70
WLAREYVWFLIPYMIYDSYAMYLCEWCRTRDQNRAPSLTLRNFLSRNRLMITHHAVILFVLVPVAQRLRG     71 - 140
DLGDFFVGCIFTAELSTPFVSLGRVLIQLKQQHTLLYKVNGILTLATFLSCRILLFPFMYWSYGRQQGLS    141 - 210
LLQVPFSIPFYCNVANAFLVAPQIYWFCLLCRKAVRLFDTPQAKKDG                           211 - 257
//

Text Mined References (11)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
20024628 2010 Silencing of CT120 by antisense oligonucleotides could inhibit the lung cancer cells growth.
16143812 2005 Inhibitory effect of CT120B, an alternative splice variant of CT120A, on lung cancer cell growth.
15927361 2006 Down-regulation of CT120A by RNA interference suppresses lung cancer cells growth and sensitizes to ultraviolet-induced apoptosis.
15625016 2004 Altered gene expression profiles of NIH3T3 cells regulated by human lung cancer associated gene CT120.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12621583 2003 Refinement of a 400-kb critical region allows genotypic differentiation between isolated lissencephaly, Miller-Dieker syndrome, and other phenotypes secondary to deletions of 17p13.3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270127 2002 Molecular cloning and characterization of CT120, a novel membrane-associated gene involved in amino acid transport and glutathione metabolism.
More...