Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.76
PubTator Score 7.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 4.48336583099148E-14
posterior fossa group A ependymoma 1511 9.04737834013855E-10
pilocytic astrocytoma 3086 4.80787050569048E-8
glioblastoma 5572 1.51421713892327E-5
atypical teratoid / rhabdoid tumor 4369 1.82142029278449E-4
interstitial cystitis 2299 7.48242042509603E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00262459775409359
cutaneous lupus erythematosus 1056 0.00467453519985348
active ulcerative colitis 477 0.0111852685734842
colon cancer 1475 0.013296028297979

Expression

Synonym

Accession Q8TBR7 A8K7Q0 Q7Z464 Q96D97 Q9H6H3
Symbols CT120

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
20024628 The researchers found evidence that CT120 may be a key factor in tumor progression and that down-regulation of CT120 may be an effective treatment for lung neoplasms.
16143812 CT120B overexpression resulted in reduction of cell growth rate & inhibited tumorigenecity & anchorage-independent growth; findings suggest that the delayed G1/S phase transition might contribute to the inhibitory activities of CT120B on cell growth
12270127 Molecular cloning and characterization of this novel membrane-associated gene involved in amino acid transport and glutathione metabolism

AA Sequence

MLLTLAGGALFFPGLFALCTWALRRSQPGWSRTDCVMISTRLVSSVHAVLATGSGIVIIRSCDDVITGRH      1 - 70
WLAREYVWFLIPYMIYDSYAMYLCEWCRTRDQNRAPSLTLRNFLSRNRLMITHHAVILFVLVPVAQRLRG     71 - 140
DLGDFFVGCIFTAELSTPFVSLGRVLIQLKQQHTLLYKVNGILTLATFLSCRILLFPFMYWSYGRQQGLS    141 - 210
LLQVPFSIPFYCNVANAFLVAPQIYWFCLLCRKAVRLFDTPQAKKDG                           211 - 257
//

Text Mined References (11)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
20024628 2010 Silencing of CT120 by antisense oligonucleotides could inhibit the lung cancer cells growth.
16143812 2005 Inhibitory effect of CT120B, an alternative splice variant of CT120A, on lung cancer cell growth.
15927361 2006 Down-regulation of CT120A by RNA interference suppresses lung cancer cells growth and sensitizes to ultraviolet-induced apoptosis.
15625016 2004 Altered gene expression profiles of NIH3T3 cells regulated by human lung cancer associated gene CT120.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12621583 2003 Refinement of a 400-kb critical region allows genotypic differentiation between isolated lissencephaly, Miller-Dieker syndrome, and other phenotypes secondary to deletions of 17p13.3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270127 2002 Molecular cloning and characterization of CT120, a novel membrane-associated gene involved in amino acid transport and glutathione metabolism.
More...