Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.200 6.4e-03
lung carcinoma 1.200 8.9e-19
malignant mesothelioma 1.100 1.0e-05
osteosarcoma -1.647 1.2e-03
spina bifida -1.006 4.1e-02
subependymal giant cell astrocytoma 1.846 1.8e-02

 Compartment GO Term (0)

AA Sequence

MSGWIATSKTRMQDFWSLLTFSSDLVDVKDSGDYPLTAPGLSWKKFQGSFCEFVGTLVCRCQYILLHDDF      1 - 70
PMDNLISLLTGFSDSQVCAFCHTSTLAAMKLMTSLVRVALQLSLHEDINQRQYEAERNKGPGQRAPERLE     71 - 140
SLLEKHKELH                                                                141 - 150
//

Text Mined References (7)

PMID Year Title