Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TBQ9 Q0P692
Symbols TMEM167

Gene

AA Sequence

MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILF      1 - 70
IQ                                                                         71 - 72
//

Text Mined References (10)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
25057126 2014 Meta-analysis identifies loci affecting levels of the potential osteoarthritis biomarkers sCOMP and uCTX-II with genome wide significance.
21269460 2011 Initial characterization of the human central proteome.
19942856 2010 A genome-wide RNA interference screen identifies two novel components of the metazoan secretory pathway.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
1316117 1992 Phenylmethanesulfonyl fluoride elicits and intensifies the clinical expression of neuropathic insults.