Property Summary

NCBI Gene PubMed Count 8
PubMed Score 56.30
PubTator Score 10.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -2.400 4.6e-02
adrenocortical carcinoma 1.021 1.4e-02
Breast cancer 2.600 2.4e-02
intraductal papillary-mucinous carcinoma... 1.500 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.900 2.0e-02
Pick disease -1.200 2.2e-03
Rheumatoid arthritis 1.300 2.9e-02

Gene RIF (3)

AA Sequence

MDPETRGQEIIKVTPLQQMLASCTGAILTSVIVTPLDVVKIRLQAQNNPLPKGKCFVYSNGLMDHLCVCE      1 - 70
EGGNKLWYKKPGNFQGTLDAFFKIIRNEGIKSLWSGLPPTLVMAVPATVIYFTCYDQLSALLRSKLGENE     71 - 140
TCIPIVAGIVARFGAVTVISPLELIRTKMQSKKFSYVELHRFVSKKVSEDGWISLWRGWAPTVLRDVPFS    141 - 210
AMYWYNYEILKKWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQLWTYESHKISMPLH    211 - 280
MSTWIIMKNIVAKNGFSGLFSGLIPRLIKIAPACAIMISTYEFGKAFFQKQNVRRQQY                281 - 338
//

Text Mined References (13)

PMID Year Title