Property Summary

NCBI Gene PubMed Count 8
PubMed Score 55.18
PubTator Score 10.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Pick disease 1893 0.00224045902544576
adrenocortical carcinoma 1427 0.0138710704864549
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0145237818314855
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0203928013997147
Breast cancer 3099 0.0242437391459974
Rheumatoid Arthritis 1171 0.0288946340771185
acute myeloid leukemia 785 0.0458142402976143
Disease Target Count Z-score Confidence
Familial combined hyperlipidemia 2 3.13 1.6

Expression

  Differential Expression (7)

Synonym

Accession Q8TBP6 A8K483 D6W5P6 Q53GB1 Q9UHR1
Symbols MCFP

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (3)

PMID Text
24268658 Joint linkage and association analysis with exome sequence data implicates SLC25A40 in hypertriglyceridemia.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDPETRGQEIIKVTPLQQMLASCTGAILTSVIVTPLDVVKIRLQAQNNPLPKGKCFVYSNGLMDHLCVCE      1 - 70
EGGNKLWYKKPGNFQGTLDAFFKIIRNEGIKSLWSGLPPTLVMAVPATVIYFTCYDQLSALLRSKLGENE     71 - 140
TCIPIVAGIVARFGAVTVISPLELIRTKMQSKKFSYVELHRFVSKKVSEDGWISLWRGWAPTVLRDVPFS    141 - 210
AMYWYNYEILKKWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQLWTYESHKISMPLH    211 - 280
MSTWIIMKNIVAKNGFSGLFSGLIPRLIKIAPACAIMISTYEFGKAFFQKQNVRRQQY                281 - 338
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24268658 2013 Joint linkage and association analysis with exome sequence data implicates SLC25A40 in hypertriglyceridemia.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16949250 2006 Fourteen novel human members of mitochondrial solute carrier family 25 (SLC25) widely expressed in the central nervous system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
More...