Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.84
PubTator Score 2.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.26836174198804E-8
ovarian cancer 8492 1.15327110310722E-5
adult high grade glioma 2148 2.81114025168976E-4
lung cancer 4473 3.15797391427597E-4
sonic hedgehog group medulloblastoma 1482 3.39777754754004E-4
osteosarcoma 7933 0.00237160572892886
astrocytoma 1493 0.00438593451966315
colon cancer 1475 0.0128313027169769
invasive ductal carcinoma 2950 0.0190510258441486
glioblastoma 5572 0.0378907907276263

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.100 0.000
osteosarcoma 1.386 0.002
astrocytoma 1.700 0.004
glioblastoma 1.400 0.038
colon cancer 1.300 0.013
lung cancer 1.900 0.000
adult high grade glioma -1.100 0.000
sonic hedgehog group medulloblastoma 1.100 0.000
invasive ductal carcinoma -1.100 0.019
ovarian cancer 1.800 0.000

Synonym

Accession Q8TBP0 B9A6L7 I3L1E0 I3L4U2 Q8N3Z4 Q96DH7
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Gene RIF (3)

PMID Text
26030178 RAB5C is identified as a new TBC1D16 target and showed that it regulates EGFR in melanoma cells.
23019362 TBC1D16 is a GTPase activating protein for Rab4A that regulates transferrin receptor recycling and EGFR trafficking and signaling.
21129771 TBC1D16 and RAB27A, were identified known drivers of melanoma both are involved in the regulation of vesicular trafficking, which highlights this process as important for proliferation in melanoma.

AA Sequence

MSLGRLLRRASSKASDLLTLTPGGSGSGSPSVLDGEIIYSKNNVCVHPPEGLQGLGEHHPGYLCLYMEKD      1 - 70
EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSGASHQPSPTELRPTLTPKDED     71 - 140
ILVVAQSVPDRMLASPAPEDEEKLAQGLGVDGAQPASQPACSPSGILSTVSPQDVTEEGREPRPEAGEED    141 - 210
GSLELSAEGVSRDSSFDSDSDTFSSPFCLSPISAALAESRGSVFLESDSSPPSSSDAGLRFPDSNGLLQT    211 - 280
PRWDEPQRVCALEQICGVFRVDLGHMRSLRLFFSDEACTSGQLVVASRESQYKVFHFHHGGLDKLSDVFQ    281 - 350
QWKYCTEMQLKDQQVAPDKTCMQFSIRRPKLPSSETHPEESMYKRLGVSAWLNHLNELGQVEEEYKLRKA    351 - 420
IFFGGIDVSIRGEVWPFLLRYYSHESTSEEREALRLQKRKEYSEIQQKRLSMTPEEHRAFWRNVQFTVDK    421 - 490
DVVRTDRNNQFFRGEDNPNVESMRRILLNYAVYNPAVGYSQGMSDLVAPILAEVLDESDTFWCFVGLMQN    491 - 560
TIFVSSPRDEDMEKQLLYLRELLRLTHVRFYQHLVSLGEDGLQMLFCHRWLLLCFKREFPEAEALRIWEA    561 - 630
CWAHYQTDYFHLFICVAIVAIYGDDVIEQQLATDQMLLHFGNLAMHMNGELVLRKARSLLYQFRLLPRIP    631 - 700
CSLHDLCKLCGSGMWDSGSMPAVECTGHHPGSESCPYGGTVEMPSPKSLREGKKGPKTPQDGFGFRR       701 - 767
//

Text Mined References (11)

PMID Year Title
26030178 2015 Epigenetic activation of a cryptic TBC1D16 transcript enhances melanoma progression by targeting EGFR.
23019362 2012 TBC1D16 is a Rab4A GTPase activating protein that regulates receptor recycling and EGF receptor signaling.
22354992 2012 Rab GTPase-activating proteins in autophagy: regulation of endocytic and autophagy pathways by direct binding to human ATG8 modifiers.
21129771 2010 An integrated approach to uncover drivers of cancer.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...