Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.40
PubTator Score 2.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 2.8e-04
astrocytoma 1.700 4.4e-03
colon cancer 1.300 1.3e-02
glioblastoma 1.400 3.8e-02
invasive ductal carcinoma -1.100 1.9e-02
lung cancer 1.900 3.2e-04
osteosarcoma 1.386 2.4e-03
ovarian cancer 1.800 1.2e-05
psoriasis -1.100 1.3e-08
sonic hedgehog group medulloblastoma 1.100 3.4e-04

Gene RIF (4)

AA Sequence

MSLGRLLRRASSKASDLLTLTPGGSGSGSPSVLDGEIIYSKNNVCVHPPEGLQGLGEHHPGYLCLYMEKD      1 - 70
EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSGASHQPSPTELRPTLTPKDED     71 - 140
ILVVAQSVPDRMLASPAPEDEEKLAQGLGVDGAQPASQPACSPSGILSTVSPQDVTEEGREPRPEAGEED    141 - 210
GSLELSAEGVSRDSSFDSDSDTFSSPFCLSPISAALAESRGSVFLESDSSPPSSSDAGLRFPDSNGLLQT    211 - 280
PRWDEPQRVCALEQICGVFRVDLGHMRSLRLFFSDEACTSGQLVVASRESQYKVFHFHHGGLDKLSDVFQ    281 - 350
QWKYCTEMQLKDQQVAPDKTCMQFSIRRPKLPSSETHPEESMYKRLGVSAWLNHLNELGQVEEEYKLRKA    351 - 420
IFFGGIDVSIRGEVWPFLLRYYSHESTSEEREALRLQKRKEYSEIQQKRLSMTPEEHRAFWRNVQFTVDK    421 - 490
DVVRTDRNNQFFRGEDNPNVESMRRILLNYAVYNPAVGYSQGMSDLVAPILAEVLDESDTFWCFVGLMQN    491 - 560
TIFVSSPRDEDMEKQLLYLRELLRLTHVRFYQHLVSLGEDGLQMLFCHRWLLLCFKREFPEAEALRIWEA    561 - 630
CWAHYQTDYFHLFICVAIVAIYGDDVIEQQLATDQMLLHFGNLAMHMNGELVLRKARSLLYQFRLLPRIP    631 - 700
CSLHDLCKLCGSGMWDSGSMPAVECTGHHPGSESCPYGGTVEMPSPKSLREGKKGPKTPQDGFGFRR       701 - 767
//

Text Mined References (12)

PMID Year Title