Property Summary

NCBI Gene PubMed Count 13
PubMed Score 35.54
PubTator Score 10.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cerebral palsy 40 3.236 1.6

Expression

  Differential Expression (3)

Protein-protein Interaction (10)

Gene RIF (1)

AA Sequence

MWSGPPQPDQGLPPPLAAVPVPWKSTDPCQGHRESPGALVETSAGEEAQGQEGPAAAQLDVLRLRSSSME      1 - 70
IREKGSEFLKEELHRAQKELKLKDEECERLSKVREQLEQELEELTASLFEEAHKMVREANMKQAASEKQL     71 - 140
KEARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRHKSTSSTLCPAVCPAAGHT    141 - 210
LTPDREGKEVDTILFAEFQAWRESPTLDKTCPFLERVYREDVGPCLDFTMQELSVLVRAAVEDNTLTIEP    211 - 280
VASQTLPTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITAVCNFFTYIRYIQQG    281 - 350
LVRQDAEPMFWEIMRLRKEMSLAKLGFFPQEA                                          351 - 382
//

Text Mined References (17)

PMID Year Title