Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.36
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.385 5.5e-06
adrenocortical carcinoma 1.068 7.1e-04
adult high grade glioma -1.400 2.0e-02
astrocytic glioma -1.300 7.8e-03
atypical teratoid / rhabdoid tumor -1.500 1.3e-03
ependymoma -1.100 1.9e-02
glioblastoma -1.100 5.2e-03
group 3 medulloblastoma -1.100 1.2e-02
intraductal papillary-mucinous adenoma (... 1.900 1.8e-03
intraductal papillary-mucinous carcinoma... 1.500 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.700 2.7e-02
juvenile dermatomyositis 1.186 4.7e-09
medulloblastoma, large-cell -1.800 6.2e-04
osteosarcoma 1.277 6.2e-04
ovarian cancer -1.500 1.3e-07
Pick disease 1.200 4.6e-03
psoriasis -1.200 2.6e-04
Rheumatoid arthritis 1.400 2.3e-02
sarcoidosis 1.100 2.0e-02

 GO Function (1)

Gene RIF (2)

AA Sequence

MEGNRDEAEKCVEIAREALNAGNREKAQRFLQKAEKLYPLPSARALLEIIMKNGSTAGNSPHCRKPSGSG      1 - 70
DQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKN     71 - 140
HAPGATDAFKKIGNAYAVLSNPEKRKQYDLTGNEEQACNHQNNGRFNFHRGCEADITPEDLFNIFFGGGF    141 - 210
PSGSVHSFSNGRAGYSQQHQHRHSGHEREEERGDGGFSVFIQLMPIIVLILVSLLSQLMVSNPPYSLYPR    211 - 280
SGTGQTIKMQTENLGVVYYVNKDFKNEYKGMLLQKVEKSVEEDYVTNIRNNCWKERQQKTDMQYAAKVYR    281 - 350
DDRLRRKADALSMDNCKELERLTSLYKGG                                             351 - 379
//

Text Mined References (14)

PMID Year Title