Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.88
PubTator Score 3.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 2.6e-08
ovarian cancer 8520 7.1e-07
cystic fibrosis 1696 1.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.898 1.3e-05
malignant mesothelioma 2.500 2.6e-08
ovarian cancer -1.500 7.1e-07

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MATQAKRPRVAGPVDGGDLDPVACFLSWCRRVGLELSPKVSERAGGRRTRGGARAALTSPPAQVAVSRQG      1 - 70
TVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQSGWVPLLLALLHELQAPASRW     71 - 140
RPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSL    141 - 210
ELYHQLVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHE    211 - 280
IFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGE    281 - 350
EGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSV    351 - 420
LLTLQTYATDLKTDQGLLSNKEVYAKLSWREQQALQVRYGQKMILHQLLELTS                     421 - 473
//

Text Mined References (15)

PMID Year Title