Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.82
PubTator Score 3.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 2.59261235898231E-8
ovarian cancer 8492 7.06803434133532E-7
cystic fibrosis 1670 1.30741050571162E-5

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 2.500 0.000
cystic fibrosis -1.898 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q8TBK2 A8K380 B5ME38 Q9H787
Symbols

Gene

PDB

3QXY   3RC0  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (6)

PMID Text
26841865 PAK4 methylation by SETD6 promotes the activation of the Wnt/beta-catenin pathway.
26780326 these findings demonstrate that SETD6 negatively regulates the Nrf2-mediated oxidative stress response through a physical and catalytically independent interaction with DJ1 at chromatin.
24751716 Several chromatin proteins that associate with SETD6 are identified and SETD6 is described as an essential factor for nuclear receptor signaling and cellular proliferation.
23324626 SETD6 monomethylates H2AZ on lysine 7.
21131967 methylation of the NF-kappaB results in repression of NF-kappaB signaling
21131967 SETD6 mono-methylate Rela on K310 and negatively regulates RelA transcription activity

AA Sequence

MATQAKRPRVAGPVDGGDLDPVACFLSWCRRVGLELSPKVSERAGGRRTRGGARAALTSPPAQVAVSRQG      1 - 70
TVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQSGWVPLLLALLHELQAPASRW     71 - 140
RPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSL    141 - 210
ELYHQLVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHE    211 - 280
IFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGE    281 - 350
EGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSV    351 - 420
LLTLQTYATDLKTDQGLLSNKEVYAKLSWREQQALQVRYGQKMILHQLLELTS                     421 - 473
//

Text Mined References (14)

PMID Year Title
26841865 2016 PAK4 Methylation by SETD6 Promotes the Activation of the Wnt/?-Catenin Pathway.
26780326 2016 SETD6 is a negative regulator of oxidative stress response.
24751716 2014 SETD6 controls the expression of estrogen-responsive genes and proliferation of breast carcinoma cells.
23324626 2013 SETD6 monomethylates H2AZ on lysine 7 and is required for the maintenance of embryonic stem cell self-renewal.
22024134 2011 A proteomic approach for the identification of novel lysine methyltransferase substrates.
21515635 2011 Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
21131967 2011 Lysine methylation of the NF-?B subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-?B signaling.
19416867 2009 The transcriptome of human CD34+ hematopoietic stem-progenitor cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...