Property Summary

NCBI Gene PubMed Count 13
Grant Count 182
R01 Count 80
Funding $34,822,699.24
PubMed Score 98.79
PubTator Score 915.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.900 0.001
ependymoma -2.600 0.000
oligodendroglioma -2.000 0.002
glioblastoma -3.200 0.000
atypical teratoid / rhabdoid tumor -2.300 0.001
primitive neuroectodermal tumor -2.800 0.004
pediatric high grade glioma -2.300 0.002
group 3 medulloblastoma 2.800 0.041
pilocytic astrocytoma -2.600 0.000
severe Alzheimer's disease -1.114 0.050
psoriasis -1.700 0.001

Synonym

Accession Q8TBJ5 A8K349 Q9BZ91 Q9NWB9
Symbols FEZ
TOF
FEZL
FKSG36
ZFP312
ZNF312

Gene

 GO Component (1)

Gene RIF (7)

PMID Text
25319688 FEZF2 expression has a role in cell proliferation and differentiation in adult neural stem cells.
24913420 Fezf1 and Fezf2 accomplish both independent and redundant functions across diverse tissue and cell types. [Review]
23826257 This study reports the differentiation of a hFezf2-YFP human embryonic stem cell reporter line into corticofugal projection neurons.
23677067 overexpression of EZH2 was frequently detected in NPC tumors. Thus, we have identified FEZF2 as a novel 3p14.2 TSG frequently inactivated by promoter methylation in NPC, which functions as a repressor downregulating multiple oncogene expression
21471212 the feasibility of employing genomic SELEX to identify vertebrate transcription factor binding sites and target genes and reveal Fezf2 as a transcription activator and a candidate for evaluation in human microcephaly.
20570630 ZNF312 and other brain-layer biomarkers have area dependent expressions in the human fetal cortex.
18976975 Knockdown of FEZ family zinc finger 2 (FEZF2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRPGALEADGSQGKKLLNLCSPL      1 - 70
PCMIPLQPLGYEVPSKTLLSYSELWKSSLRAGGGGGGGGGGGGGGGGAPVCGASGLCKTNCGVCCKAELG     71 - 140
LAPSALPAGRVIKPQVINQAVGLPASGSLYYFNYLDSTAYPPSELLSGHLFPSGLLNAQAPAALAAHPKL    141 - 210
FLLENAKLAGLAADKFPHPAPYPHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADGKPKNFTCE    211 - 280
VCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNT    281 - 350
HIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCA    351 - 420
TCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS                                   421 - 459
//

Text Mined References (15)

PMID Year Title
26544942 2015 Fezf2 Orchestrates a Thymic Program of Self-Antigen Expression for Immune Tolerance.
25319688 2014 Heterogeneously expressed fezf2 patterns gradient Notch activity in balancing the quiescence, proliferation, and differentiation of adult neural stem cells.
24913420 2014 Fez family transcription factors: controlling neurogenesis and cell fate in the developing mammalian nervous system.
23826257 2013 Directed differentiation of human embryonic stem cells into corticofugal neurons uncovers heterogeneous Fezf2-expressing subpopulations.
23677067 2013 FEZF2, a novel 3p14 tumor suppressor gene, represses oncogene EZH2 and MDM2 expression and is frequently methylated in nasopharyngeal carcinoma.
21471212 2011 Genomic selection identifies vertebrate transcription factor Fezf2 binding sites and target genes.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
20570630 2010 Area dependent expression of ZNF312 in human fetal cerebral cortex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...