Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.13
PubTator Score 2.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Seizures 596 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 1.0e-03
atypical teratoid / rhabdoid tumor -2.500 1.7e-03
ependymoma -2.100 2.6e-05
group 3 medulloblastoma 1.400 4.2e-02
lung cancer -1.500 1.3e-02
nephrosclerosis -1.716 1.6e-03
Pick disease -1.100 2.6e-02
psoriasis -1.400 8.8e-16
subependymal giant cell astrocytoma -1.721 3.2e-02

Synonym

Accession Q8TBJ4 Q5VX23 Q9NXE2
Symbols LPPR1
PRG-3

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

AA Sequence

MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITP      1 - 70
LVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDI     71 - 140
FVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALY    141 - 210
ATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFK    211 - 280
GTQGSPSKPKPEDPRGVPLMAFPRIESPLETLSAQNHSASMTEVT                             281 - 325
//

Text Mined References (8)

PMID Year Title