Property Summary

NCBI Gene PubMed Count 5
Grant Count 1
Funding $693,563
PubMed Score 0.63
PubTator Score 2.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
nephrosclerosis -1.716 0.002
posterior fossa group A ependymoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.500 0.002
lung cancer -1.500 0.013
group 3 medulloblastoma 1.400 0.042
pilocytic astrocytoma 1.600 0.001
subependymal giant cell astrocytoma -1.721 0.032
Pick disease -1.100 0.026
psoriasis -1.400 0.000

AA Sequence

MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITP      1 - 70
LVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDI     71 - 140
FVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALY    141 - 210
ATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFK    211 - 280
GTQGSPSKPKPEDPRGVPLMAFPRIESPLETLSAQNHSASMTEVT                             281 - 325
//

Text Mined References (8)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14750979 2004 Molecular cloning and expression regulation of PRG-3, a new member of the plasticity-related gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12730698 2003 A new phospholipid phosphatase, PRG-1, is involved in axon growth and regenerative sprouting.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.