Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 1.3e-04
diabetes mellitus -1.200 9.7e-03
ependymoma -1.200 3.1e-06
group 4 medulloblastoma -1.800 6.9e-05
intraductal papillary-mucinous adenoma (... 1.200 9.0e-04
intraductal papillary-mucinous carcinoma... 1.100 1.4e-03
lung adenocarcinoma -1.500 1.6e-09
lung carcinoma -1.200 3.5e-09
medulloblastoma, large-cell -1.700 3.8e-05
osteosarcoma -1.174 2.2e-04
pancreatic ductal adenocarcinoma liver m... 1.004 1.9e-02
pediatric high grade glioma -1.100 1.3e-03
tuberculosis -1.200 1.5e-05

Synonym

Accession Q8TBH0 B2RBG9 O95895 Q6ZRV9 Q8WYG6
Symbols PP2703
CLONE24945

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWTESRSAGSSTA      1 - 70
YTQSYSERVEVVSHRATLLAPDTGETTTLPPGRHEFLFSFQLPPTLVTSFEGKHGSVRYCIKATLHRPWV     71 - 140
PARRARKVFTVIEPVDINTPALLAPQAGAREKVARSWYCNRGLVSLSAKIDRKGYTPGEVIPVFAEIDNG    141 - 210
STRPVLPRAAVVQTQTFMARGARKQKRAVVASLAGEPVGPGQRALWQGRALRIPPVGPSILHCRVLHVDY    211 - 280
ALKVCVDIPGTSKLLLELPLVIGTIPLHPFGSRSSSVGSHASFLLDWRLGALPERPEAPPEYSEVVADTE    281 - 350
EAALGQSPFPLPQDPDMSLEGPFFAYIQEFRYRPPPLYSEEDPNPLLGDMRPRCMTC                 351 - 407
//

Text Mined References (8)

PMID Year Title