Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 3.38600429328952E-16
lung carcinoma 2844 3.52579073580253E-9
atypical teratoid/rhabdoid tumor 1095 2.28074185041135E-6
ependymoma 2514 3.13664397900916E-6
tuberculosis 1563 1.51861184002011E-5
medulloblastoma, large-cell 6234 3.79406229042618E-5
group 4 medulloblastoma 1875 6.90400872673471E-5
osteosarcoma 7933 2.21133175810687E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 8.97795098753103E-4
pediatric high grade glioma 2712 0.00129050948793681
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00137877003967428
diabetes mellitus 1663 0.00968514302907474
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0190802610603699

Expression

Synonym

Accession Q8TBH0 B2RBG9 O95895 Q6ZRV9 Q8WYG6
Symbols PP2703
CLONE24945

Gene

  Ortholog (12)

AA Sequence

MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWTESRSAGSSTA      1 - 70
YTQSYSERVEVVSHRATLLAPDTGETTTLPPGRHEFLFSFQLPPTLVTSFEGKHGSVRYCIKATLHRPWV     71 - 140
PARRARKVFTVIEPVDINTPALLAPQAGAREKVARSWYCNRGLVSLSAKIDRKGYTPGEVIPVFAEIDNG    141 - 210
STRPVLPRAAVVQTQTFMARGARKQKRAVVASLAGEPVGPGQRALWQGRALRIPPVGPSILHCRVLHVDY    211 - 280
ALKVCVDIPGTSKLLLELPLVIGTIPLHPFGSRSSSVGSHASFLLDWRLGALPERPEAPPEYSEVVADTE    281 - 350
EAALGQSPFPLPQDPDMSLEGPFFAYIQEFRYRPPPLYSEEDPNPLLGDMRPRCMTC                 351 - 407
//

Text Mined References (7)

PMID Year Title
23236378 2012 Mammalian ? arrestins link activated seven transmembrane receptors to Nedd4 family e3 ubiquitin ligases and interact with ? arrestins.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.