Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.76
PubTator Score 4.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -4.500 3.3e-07
astrocytic glioma -3.700 2.4e-03
Astrocytoma, Pilocytic -6.400 1.4e-14
atypical teratoid / rhabdoid tumor -3.600 2.1e-04
ependymoma -5.700 7.4e-04
glioblastoma -5.000 1.3e-10
group 3 medulloblastoma -2.600 8.5e-03
medulloblastoma, large-cell -3.800 4.4e-05
oligodendroglioma -3.700 7.1e-03
Pick disease -2.000 1.6e-02
primitive neuroectodermal tumor -3.800 6.9e-03
psoriasis 1.400 2.6e-06

 GO Function (1)

Gene RIF (4)

AA Sequence

MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLA      1 - 70
LIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLS     71 - 140
DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRY    141 - 210
LSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI                   211 - 265
//

Text Mined References (17)

PMID Year Title