Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
Funding $45,389.6
PubMed Score 12.27
PubTator Score 4.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -3.700 0.002
posterior fossa group A ependymoma -6.500 0.000
oligodendroglioma -3.700 0.007
glioblastoma -5.500 0.000
sonic hedgehog group medulloblastoma -5.300 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -3.800 0.007
pediatric high grade glioma -5.100 0.000
pilocytic astrocytoma -6.500 0.000
Pick disease -2.000 0.016
psoriasis 1.400 0.000

Synonym

Accession Q8TBG9 B2R675 G5E9W4
Symbols SPO

Gene

 Grant Application (1)

 GO Function (1)

Gene RIF (4)

PMID Text
25138779 Results from genome-wide association studies identify synaptoporin gene as one of the three susceptibility loci candidate for congenital left-sided lesions.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12974474 cloning and characterization of the human cDNA that encodes the human homologue of synaptoporin
12740598 Tyrosine nitration of synaptophysin is related to Amyloid beta induced impairment of acetylcholine release.

AA Sequence

MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLA      1 - 70
LIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLS     71 - 140
DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRY    141 - 210
LSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI                   211 - 265
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25138779 2015 Genome-wide association study of maternal and inherited effects on left-sided cardiac malformations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...