Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.28
PubTator Score 3.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 3.07888907841163E-12
pilocytic astrocytoma 3086 4.26029092035174E-10
ovarian cancer 8492 9.62707947049005E-8
atypical teratoid / rhabdoid tumor 4369 1.73441620309872E-7
group 3 medulloblastoma 2254 2.09933143371057E-7
medulloblastoma, large-cell 6234 2.13060526114683E-6
pediatric high grade glioma 2712 3.60932031642926E-6
primitive neuroectodermal tumor 3031 6.74150134388089E-5
glioblastoma 5572 8.33447293994715E-5
facioscapulohumeral dystrophy 286 7.5977419408251E-4
subependymal giant cell astrocytoma 2287 0.00110750668015722
oligodendroglioma 2849 0.00260040746081994
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0037813907083035
Down syndrome 548 0.0112443456999034
gastric carcinoma 832 0.0207810319073916
spina bifida 1064 0.030648735045326
nephrosclerosis 329 0.0354615567530943

Expression

  Differential Expression (17)

Disease log2 FC p
nephrosclerosis -1.035 0.035
glioblastoma -5.700 0.000
oligodendroglioma -1.500 0.003
ependymoma -5.100 0.000
group 3 medulloblastoma -6.000 0.000
atypical teratoid / rhabdoid tumor -6.000 0.000
medulloblastoma, large-cell -7.000 0.000
primitive neuroectodermal tumor -5.500 0.000
pancreatic ductal adenocarcinoma liver m... -3.147 0.004
pediatric high grade glioma -5.100 0.000
pilocytic astrocytoma -5.800 0.000
subependymal giant cell astrocytoma -5.339 0.001
spina bifida -4.266 0.031
gastric carcinoma -3.900 0.021
ovarian cancer -1.100 0.000
Down syndrome 1.800 0.011
facioscapulohumeral dystrophy 2.500 0.001

Synonym

Accession Q8TBG4 B7Z1Y0 E9PBY0 Q9H174
Symbols AGXT2L1

Gene

PANTHER Protein Class (2)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA Inparanoid

Gene RIF (4)

PMID Text
26294768 AGXT2L1 is down-regulated in hepatocellular carcinoma and its low expression indicates a poor prognosis. AGXT2L1 is a crucial gene in the abnormal lipogenesis of HCC tissue.
25327712 The pH dependence of the catalytic parameters and the pattern of inhibition by the product phosphate and by other anionic compounds suggest that the active site of PEA phospho-lyase is optimized to bind dianionic groups.
23761375 AGXT2L1 function appears to be rigidly confined to phospholipid metabolism, which is altered in neuropsychiatric disturbances.
20332099 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHVGHCHPGVVKAA      1 - 70
LKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYH     71 - 140
GHLSSLIEISPYKFQKGKDVKKEFVHVAPTPDTYRGKYREDHADSASAYADEVKKIIEDAHNSGRKIAAF    141 - 210
IAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPM    211 - 280
GNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQ    281 - 350
KAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEE    351 - 420
DAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENPSRKRNGMCTDTH    421 - 490
SLLSKRLKT                                                                 491 - 499
//

Text Mined References (10)

PMID Year Title
26294768 2016 AGXT2L1 is down-regulated in heptocellular carcinoma and associated with abnormal lipogenesis.
25327712 2015 Kinetic characterization of the human O-phosphoethanolamine phospho-lyase reveals unconventional features of this specialized pyridoxal phosphate-dependent lyase.
23761375 2013 Strict reaction and substrate specificity of AGXT2L1, the human O-phosphoethanolamine phospho-lyase.
22241472 2012 Molecular identification of hydroxylysine kinase and of ammoniophospholyases acting on 5-phosphohydroxy-L-lysine and phosphoethanolamine.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7592550 1995 Molecular cloning and sequencing of a cDNA encoding alanine-glyoxylate aminotransferase 2 from rat kidney.