Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.28
PubTator Score 3.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -4.500 3.7e-06
Astrocytoma, Pilocytic -5.700 4.9e-10
atypical teratoid / rhabdoid tumor -6.000 1.7e-07
Down syndrome 1.800 1.1e-02
ependymoma -5.100 3.1e-12
facioscapulohumeral dystrophy 2.500 7.6e-04
gastric carcinoma -3.900 2.1e-02
glioblastoma -4.700 2.6e-07
group 3 medulloblastoma -6.000 2.1e-07
medulloblastoma, large-cell -7.000 2.1e-06
nephrosclerosis -1.035 3.5e-02
oligodendroglioma -1.500 2.6e-03
ovarian cancer -1.100 9.6e-08
pancreatic ductal adenocarcinoma liver m... -3.147 3.8e-03
primitive neuroectodermal tumor -5.500 6.7e-05
spina bifida -4.266 3.1e-02
subependymal giant cell astrocytoma -5.339 1.1e-03

Gene RIF (4)

AA Sequence

MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHVGHCHPGVVKAA      1 - 70
LKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYH     71 - 140
GHLSSLIEISPYKFQKGKDVKKEFVHVAPTPDTYRGKYREDHADSASAYADEVKKIIEDAHNSGRKIAAF    141 - 210
IAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPM    211 - 280
GNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQ    281 - 350
KAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEE    351 - 420
DAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENPSRKRNGMCTDTH    421 - 490
SLLSKRLKT                                                                 491 - 499
//

Text Mined References (10)

PMID Year Title