Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.38
PubTator Score 1.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.440 0.000
tuberculosis and treatment for 6 months -1.500 0.001
non-small cell lung cancer 2.193 0.000
ovarian cancer 1.100 0.004

Synonym

Accession Q8TBF5 Q9NWZ2 PIG-X
Symbols PIG-X

Gene

Gene RIF (1)

PMID Text
15635094 mammalian PIG-X and yeast Pbn1p are the essential components of glycosylphosphatidylinositol-mannosyltransferase I

AA Sequence

MAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRDLLIKVKFGES      1 - 70
IEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCID     71 - 140
CFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYK    141 - 210
SVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL                          211 - 258
//

Text Mined References (9)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15635094 2005 Mammalian PIG-X and yeast Pbn1p are the essential components of glycosylphosphatidylinositol-mannosyltransferase I.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11102867 2000 Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.