Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 1.11652712726935E-7
group 4 medulloblastoma 1875 4.81535388552475E-6
pancreatic cancer 2300 1.3986777158948E-5
pilocytic astrocytoma 3086 4.81709788155765E-5
ovarian cancer 8492 1.32850412592674E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.51515199589873E-4
medulloblastoma, large-cell 6234 7.46263782403986E-4
invasive ductal carcinoma 2950 0.00206013348283496
adult high grade glioma 2148 0.00239827082850933
adrenocortical carcinoma 1427 0.00379474824623244
ependymoma 2514 0.00528424490052429
non primary Sjogren syndrome sicca 840 0.0141062095173502
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0145695372896867
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0196080902990865
Disease Target Count Z-score Confidence
ulcerative colitis 2087 0.0 2.0

Expression

AA Sequence

MSTVDLARVGACILKHAVTGEAVELRSLWREHACVVAGLRRFGCVVCRWIAQDLSSLAGLLDQHGVRLVG      1 - 70
VGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSG     71 - 140
DLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV                141 - 198
//

Text Mined References (13)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006499 2008 Molecular characterization of a novel type of prostamide/prostaglandin F synthase, belonging to the thioredoxin-like superfamily.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14710190 2004 Reconsidering the evolution of eukaryotic selenoproteins: a novel nonmammalian family with scattered phylogenetic distribution.
More...