Property Summary

NCBI Gene PubMed Count 8
PubMed Score 234.67
PubTator Score 8.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 6.2e-04
Disease Target Count Z-score Confidence
Malaria 160 6.646 3.3
Tetanus 68 3.321 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 6.2e-04

Synonym

Accession Q8TBE9 B3KP12 Q5JYN8 Q8TE97 Q9Y3N0
Symbols HDHD4
C20orf147
dJ694B14.3

Gene

PDB

2W4M   4KNV   4KNW  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITD      1 - 70
LRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQRE     71 - 140
KIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWIN    141 - 210
KNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST                                    211 - 248
//

Text Mined References (8)

PMID Year Title