Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.88
PubTator Score 1.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Melanoma 261
Disease Target Count P-value
lung carcinoma 2844 3.29705834048828E-27
ovarian cancer 8492 1.18040399159717E-10
nephrosclerosis 329 1.61394225477814E-4
interstitial cystitis 2299 2.87214514306392E-4
ductal carcinoma in situ 1745 5.94527521079684E-4
breast carcinoma 1614 9.19435728136467E-4
cystic fibrosis 1670 0.00149301956085691
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00226507562728353
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00518659922927973
invasive ductal carcinoma 2950 0.0113310621551522
subependymal giant cell astrocytoma 2287 0.0130254435801881
oligodendroglioma 2849 0.0142143950525263
ependymoma 2514 0.0176081409818762
fibroadenoma 557 0.0345706790584375
astrocytic glioma 2241 0.0379458261036281

Expression

  Differential Expression (15)

Disease log2 FC p
nephrosclerosis 1.095 0.000
astrocytic glioma -1.300 0.038
ependymoma -1.500 0.018
oligodendroglioma -1.700 0.014
intraductal papillary-mucinous adenoma (... -1.800 0.005
intraductal papillary-mucinous carcinoma... -1.800 0.002
breast carcinoma -1.300 0.001
fibroadenoma -1.400 0.035
interstitial cystitis 1.300 0.000
cystic fibrosis 1.100 0.001
subependymal giant cell astrocytoma -2.569 0.013
lung carcinoma 1.400 0.000
ductal carcinoma in situ -1.300 0.001
invasive ductal carcinoma -1.400 0.011
ovarian cancer -1.800 0.000

Synonym

Accession Q8TBE7 B2RA80 D3DNE1 Q9BWN4 Q9H0S6
Symbols TMEM22

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
19148500 the TMEM22/RAB37 complex is likely to play a crucial role in growth of renal cell carcinoma

AA Sequence

MDTSPSRKYPVKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEGYGNFMEENPKKGLLSEMKKKGRAFFG      1 - 70
TMDTLPPPTEDPMINEIGQFQSFAEKNIFQSRKMWIVLFGSALAHGCVALITRLVSDRSKVPSLELIFIR     71 - 140
SVFQVLSVLVVCYYQEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILA    141 - 210
FLLVDEKMAYVDMATVVCSILGVCLVMIPNIVDEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKE    211 - 280
KISMWTALFTFGWTGTIWGISTMFILQEPIIPLDGETWSYLIAICVCSTAAFLGVYYALDKFHPALVSTV    281 - 350
QHLEIVVAMVLQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRKQDYQEILDSPIK            351 - 412
//

Text Mined References (16)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19148500 2009 Involvement of TMEM22 overexpression in the growth of renal cell carcinoma cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...