Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.88
PubTator Score 1.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.300 3.8e-02
breast carcinoma -1.300 9.2e-04
cystic fibrosis 1.100 1.5e-03
ductal carcinoma in situ -1.300 5.9e-04
ependymoma -1.500 1.8e-02
fibroadenoma -1.400 3.5e-02
interstitial cystitis 1.300 2.9e-04
intraductal papillary-mucinous adenoma (... -1.800 5.2e-03
intraductal papillary-mucinous carcinoma... -1.800 2.3e-03
invasive ductal carcinoma -1.400 1.1e-02
lung carcinoma 1.400 3.3e-27
nephrosclerosis 1.095 1.6e-04
oligodendroglioma -1.700 1.4e-02
ovarian cancer -1.800 1.2e-10
subependymal giant cell astrocytoma -2.569 1.3e-02

Gene RIF (2)

AA Sequence

MDTSPSRKYPVKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEGYGNFMEENPKKGLLSEMKKKGRAFFG      1 - 70
TMDTLPPPTEDPMINEIGQFQSFAEKNIFQSRKMWIVLFGSALAHGCVALITRLVSDRSKVPSLELIFIR     71 - 140
SVFQVLSVLVVCYYQEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILA    141 - 210
FLLVDEKMAYVDMATVVCSILGVCLVMIPNIVDEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKE    211 - 280
KISMWTALFTFGWTGTIWGISTMFILQEPIIPLDGETWSYLIAICVCSTAAFLGVYYALDKFHPALVSTV    281 - 350
QHLEIVVAMVLQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRKQDYQEILDSPIK            351 - 412
//

Text Mined References (16)

PMID Year Title