Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.88
PubTator Score 1.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
nephrosclerosis 1.095 0.000
astrocytic glioma -1.300 0.038
ependymoma -1.500 0.018
oligodendroglioma -1.700 0.014
intraductal papillary-mucinous adenoma (... -1.800 0.005
intraductal papillary-mucinous carcinoma... -1.800 0.002
breast carcinoma -1.300 0.001
fibroadenoma -1.400 0.035
interstitial cystitis 1.300 0.000
cystic fibrosis 1.100 0.001
subependymal giant cell astrocytoma -2.569 0.013
lung carcinoma 1.400 0.000
ductal carcinoma in situ -1.300 0.001
invasive ductal carcinoma -1.400 0.011
ovarian cancer -1.800 0.000

Synonym

Accession Q8TBE7 B2RA80 D3DNE1 Q9BWN4 Q9H0S6
Symbols TMEM22

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
19148500 the TMEM22/RAB37 complex is likely to play a crucial role in growth of renal cell carcinoma

AA Sequence

MDTSPSRKYPVKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEGYGNFMEENPKKGLLSEMKKKGRAFFG      1 - 70
TMDTLPPPTEDPMINEIGQFQSFAEKNIFQSRKMWIVLFGSALAHGCVALITRLVSDRSKVPSLELIFIR     71 - 140
SVFQVLSVLVVCYYQEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILA    141 - 210
FLLVDEKMAYVDMATVVCSILGVCLVMIPNIVDEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKE    211 - 280
KISMWTALFTFGWTGTIWGISTMFILQEPIIPLDGETWSYLIAICVCSTAAFLGVYYALDKFHPALVSTV    281 - 350
QHLEIVVAMVLQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRKQDYQEILDSPIK            351 - 412
//

Text Mined References (16)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19148500 2009 Involvement of TMEM22 overexpression in the growth of renal cell carcinoma cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...