Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.700 1.0e-02
astrocytic glioma -1.400 2.5e-02
Astrocytoma, Pilocytic -2.200 7.9e-06
atypical teratoid / rhabdoid tumor -2.300 7.2e-07
ependymoma -1.900 5.6e-03
glioblastoma -2.100 1.0e-06
group 3 medulloblastoma -2.300 2.3e-02
medulloblastoma, large-cell -2.000 4.1e-03
oligodendroglioma -1.400 1.6e-02
pituitary cancer -3.600 2.4e-07
psoriasis 2.600 1.1e-11

Synonym

Accession Q8TBE3 A8K0Y6
Symbols C5orf40

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MNIEVGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHHEEKVPRTISSVVLEHLAPST      1 - 70
LYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSSLVDPQISLWVLMAILLACFTAVLAFICLQFWCVRC     71 - 140
HEPRWSYRAGHMEEANGLVRWPEEAPDLGQREEDLQGLPLVEMPRKNSRDGAELDPEANQDAPDAGALQR    141 - 210
GGGDPPAILPHCGE                                                            211 - 224
//

Text Mined References (7)

PMID Year Title