Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.57
PubTator Score 1.03

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TBE1 CNIH-3
Symbols CNIH-3

Gene

 GO Function (1)

Gene RIF (2)

PMID Text
23103966 Significant upregulation of CNIH-3 mRNA expression was found in schizophrenia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLP      1 - 70
EYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLA     71 - 140
FYLLSFFYYLYCMIYTLVSS                                                      141 - 160
//

Text Mined References (10)

PMID Year Title
23103966 2012 Upregulation of cornichon transcripts in the dorsolateral prefrontal cortex in schizophrenia.
20805473 2010 Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.