Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.61
PubTator Score 1.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

 GO Function (1)

 GWAS Trait (2)

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLP      1 - 70
EYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLA     71 - 140
FYLLSFFYYLYCMIYTLVSS                                                      141 - 160
//

Text Mined References (11)

PMID Year Title