Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.27
PubTator Score 0.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease -1.051 2.0e-02
Breast cancer -1.400 1.9e-09
Common variable immunodeficiency -1.463 2.8e-03
cystic fibrosis 1.200 9.4e-04
glioblastoma -1.100 1.5e-03
intraductal papillary-mucinous adenoma (... -1.700 9.8e-03
intraductal papillary-mucinous carcinoma... -2.800 6.2e-04
intraductal papillary-mucinous neoplasm ... -3.400 6.3e-05
malignant mesothelioma -3.100 1.6e-08
medulloblastoma, large-cell -1.400 8.8e-05
non-small cell lung cancer -1.185 4.8e-13
osteosarcoma 1.598 2.5e-03
ovarian cancer -1.300 2.6e-09
Pick disease -1.300 2.9e-05
pituitary cancer -1.100 1.4e-03
psoriasis -2.400 5.2e-12
subependymal giant cell astrocytoma -1.398 1.5e-02

Gene RIF (1)

AA Sequence

MLPLEKAFASPRSSPAPPDLPTPGSAAGVQQEEPETIPERTPADLEFSRLRFREFVYQEAAGPHQTLARL      1 - 70
HELCRQWLMPEARSKEQMLELLVLEQFLGILPDKVRPWVVAQYPESCKKAASLVEGLADVLEEPGMLLGS     71 - 140
PAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPAPSETPWLSPDPLFLEQRRVREAKTEEDGPA    141 - 210
NTEQKLKSFPEDPQHLGEWGHLDPAEENLKSYRKLLLWGYQLSQPDAASRLDTEELRLVERDPQGSSLPE    211 - 280
GGRRQESAGCACEEAAPAGVLPELPTEAPPGDALADPPSGTTEEEEEQPGKAPDPQDPQDAESDSATGSQ    281 - 350
RQSVIQQPAPDRGTAKLGTKRPHPEDGDGQSLEGVSSSGDSAGLEAGQGPGADEPGLSRGKPYACGECGE    351 - 420
AFAWLSHLMEHHSSHGGRKRYACQGCWKTFHFSLALAEHQKTHEKEKSYALGGARGPQPSTREAQAGARA    421 - 490
GGPPESVEGEAPPAPPEAQR                                                      491 - 510
//

Text Mined References (7)

PMID Year Title