Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.34
PubTator Score 0.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 5.17873172450429E-12
ovarian cancer 8492 7.85350703811592E-11
non-small cell lung cancer 2798 1.23205078220985E-10
Breast cancer 3099 1.87717219628759E-9
malignant mesothelioma 3163 1.61276596053079E-8
osteosarcoma 7933 4.61759394316599E-6
Pick disease 1893 2.87702321720015E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.31585883447752E-5
medulloblastoma, large-cell 6234 8.7621381296173E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.17038755551727E-4
cystic fibrosis 1670 9.38384345405842E-4
pituitary cancer 1972 0.00142844563699483
glioblastoma 5572 0.00148566194492289
Common variable immunodeficiency 98 0.00275343965568445
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00983380863025677
subependymal giant cell astrocytoma 2287 0.0149678056427302
active Crohn's disease 918 0.0195438618305531
Disease Target Count Z-score Confidence
Cholangiocarcinoma 32 3.245 1.6

Expression

Synonym

Accession Q8TBC5 B4DG23 E9PBI0 Q9BRK7 Q9H9A0
Symbols ZNF447

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG

Pathway (1)

Gene RIF (1)

PMID Text
24948044 A high negative correlation between promoter DNA methylation and gene expression was observed for CDO1, ZNF331 and ZSCAN18 in gastrointestinal tumors.

AA Sequence

MLPLEKAFASPRSSPAPPDLPTPGSAAGVQQEEPETIPERTPADLEFSRLRFREFVYQEAAGPHQTLARL      1 - 70
HELCRQWLMPEARSKEQMLELLVLEQFLGILPDKVRPWVVAQYPESCKKAASLVEGLADVLEEPGMLLGS     71 - 140
PAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPAPSETPWLSPDPLFLEQRRVREAKTEEDGPA    141 - 210
NTEQKLKSFPEDPQHLGEWGHLDPAEENLKSYRKLLLWGYQLSQPDAASRLDTEELRLVERDPQGSSLPE    211 - 280
GGRRQESAGCACEEAAPAGVLPELPTEAPPGDALADPPSGTTEEEEEQPGKAPDPQDPQDAESDSATGSQ    281 - 350
RQSVIQQPAPDRGTAKLGTKRPHPEDGDGQSLEGVSSSGDSAGLEAGQGPGADEPGLSRGKPYACGECGE    351 - 420
AFAWLSHLMEHHSSHGGRKRYACQGCWKTFHFSLALAEHQKTHEKEKSYALGGARGPQPSTREAQAGARA    421 - 490
GGPPESVEGEAPPAPPEAQR                                                      491 - 510
//

Text Mined References (7)

PMID Year Title
24948044 2015 The novel colorectal cancer biomarkers CDO1, ZSCAN18 and ZNF331 are frequently methylated across gastrointestinal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.