Property Summary

NCBI Gene PubMed Count 30
Grant Count 11
R01 Count 10
Funding $426,914.79
PubMed Score 11.67
PubTator Score 13.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.245 0.008
Multiple myeloma 1.081 0.015
juvenile dermatomyositis 1.057 0.000
Amyotrophic Lateral Sclerosis 1.111 0.000
acute quadriplegic myopathy 1.001 0.001
dermatomyositis 1.600 0.006

Gene RIF (10)

PMID Text
25229838 E1 (NAE1 and UBA3) and E2 (UBC12) enzymes, as well as global NEDD8 conjugation, were upregulated in over 2/3 of human intrahepatic cholangiocarcinoma
24691136 The study demonstrated that two mutations in UBA3 which were not previously reported confer MLN4924 resistance to MLN4924, a selective NEDD8-activating enzyme inhibitor.
24525735 Report role for neddylation via Nedd8-activating enzyme in the regulation of tumor angiogenesis.
22821745 Demonstrated that Uba3-betaGD is an independently folded domain in solution and that residues involved in E2 binding are absent from the NMR spectrum, indicating that the E2-binding surface on Uba3-betaGD interconverts between multiple conformations.
22404213 Knockdown of ubiquitin-like modifier activating enzyme 3 (UBA3) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
18652489 X-ray crystallographic analysis of APPBP1-UBA3-NEDD8 shows that APPBP1-UBA3's preference for NEDD8's Ala72 appears to be indirect, due to proper positioning of UBA3's Arg190.
15694336 crystal structure of a complex between the C-terminal domain from NEDD8's heterodimeric E1 (APPBP1-UBA3) and the catalytic core domain of NEDD8's E2 (Ubc12)
14690597 Data report the structure of the quaternary complex between human APPBP1-UBA3, a heterodimeric E1, its ubl NEDD8, and ATP.
12740388 Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer.
12646924 structure and mutational analysis of human APPBP1-UBA3, the heterodimeric E1 enzyme for NEDD8

AA Sequence

MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTC      1 - 70
KVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCN     71 - 140
VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNA    141 - 210
RVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQW    211 - 280
IFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDG    281 - 350
LYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTS    351 - 420
IEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS                               421 - 463
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25229838 2014 Neddylation pathway is up-regulated in human intrahepatic cholangiocarcinoma and serves as a potential therapeutic target.
24691136 2014 Mutations in UBA3 confer resistance to the NEDD8-activating enzyme inhibitor MLN4924 in human leukemic cells.
24525735 2014 Suppression of tumor angiogenesis by targeting the protein neddylation pathway.
22821745 2012 E2-binding surface on Uba3 ?-grasp domain undergoes a conformational transition.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19250909 2009 E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification.
18652489 2008 Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
More...