Property Summary

NCBI Gene PubMed Count 30
PubMed Score 12.52
PubTator Score 13.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.001 1.4e-03
Amyotrophic lateral sclerosis 1.111 2.2e-05
dermatomyositis 1.600 6.0e-03
juvenile dermatomyositis 1.057 5.8e-08
Multiple myeloma 1.081 1.5e-02
Waldenstrons macroglobulinemia 1.245 7.6e-03

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTC      1 - 70
KVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCN     71 - 140
VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNA    141 - 210
RVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQW    211 - 280
IFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDG    281 - 350
LYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTS    351 - 420
IEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS                               421 - 463
//

Text Mined References (33)

PMID Year Title