Property Summary

NCBI Gene PubMed Count 10
PubMed Score 59.40
PubTator Score 80.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 0.7
Disease Target Count Z-score Confidence
Hypogonadotropism 11 3.897 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 4.3e-09
glioblastoma 1.500 1.6e-06
medulloblastoma, large-cell 1.600 2.1e-05
osteosarcoma -1.098 2.4e-03
pediatric high grade glioma 1.100 6.6e-06
primitive neuroectodermal tumor 1.200 1.2e-04

Gene RIF (3)

AA Sequence

MAAAATAAEGVPSRGPPGEVIHLNVGGKRFSTSRQTLTWIPDSFFSSLLSGRISTLKDETGAIFIDRDPT      1 - 70
VFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRSSCGNVLFNGYLPPPVFPVKRR     71 - 140
NRHSLVGPQQLGGRPAPVRRSNTMPPNLGNAGLLGRMLDEKTPPSPSGQPEEPGMVRLVCGHHNWIAVAY    141 - 210
TQFLVCYRLKEASGWQLVFSSPRLDWPIERLALTARVHGGALGEHDKMVAAATGSEILLWALQAEGGGSE    211 - 280
IGVFHLGVPVEALFFVGNQLIATSHTGRIGVWNAVTKHWQVQEVQPITSYDAAGSFLLLGCNNGSIYYVD    281 - 350
VQKFPLRMKDNDLLVSELYRDPAEDGVTALSVYLTPKTSDSGNWIEIAYGTSSGGVRVIVQHPETVGSGP    351 - 420
QLFQTFTVHRSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILALESADGHGG    421 - 490
CSAGNDIGPYGERDDQQVFIQKVVPSASQLFVRLSSTGQRVCSVRSVDGSPTTAFTVLECEGSRRLGSRP    491 - 560
RRYLLTGQANGSLAMWDLTTAMDGLGQAPAGGLTEQELMEQLEHCELAPPAPSAPSWGCLPSPSPRISLT    561 - 630
SLHSASSNTSLSGHRGSPSPPQAEARRRGGGSFVERCQELVRSGPDLRRPPTPAPWPSSGLGTPLTPPKM    631 - 700
KLNETSF                                                                   701 - 707
//

Text Mined References (18)

PMID Year Title