Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.55
PubTator Score 2.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.500 1.0e-06
astrocytic glioma -2.000 1.2e-03
Astrocytoma, Pilocytic -2.200 1.7e-08
atypical teratoid / rhabdoid tumor -3.700 1.3e-13
ependymoma -3.200 2.0e-16
glioblastoma -2.500 2.3e-08
lung carcinoma 1.500 8.1e-12
medulloblastoma, large-cell -1.400 6.4e-05
oligodendroglioma -1.400 3.0e-09
Pick disease -1.500 2.4e-02
pituitary cancer 1.200 3.0e-04
primitive neuroectodermal tumor -2.400 2.1e-03
sonic hedgehog group medulloblastoma -1.700 3.4e-03
subependymal giant cell astrocytoma -2.611 5.0e-02

Gene RIF (4)

AA Sequence

MSGFFTSLDPRRVQWGAAWYAMHSRILRTKPVESMLEGTGTTTAHGTKLAQVLTTVDLISLGVGSCVGTG      1 - 70
MYVVSGLVAKEMAGPGVIVSFIIAAVASILSGVCYAEFGVRVPKTTGSAYTYSYVTVGEFVAFFIGWNLI     71 - 140
LEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGLGKGEESYPDLLALLIAVIVTIIVALGVKNS    141 - 210
IGFNNVLNVLNLAVWVFIMIAGLFFINGKYWAEGQFLPHGWSGVLQGAATCFYAFIGFDIIATTGEEAKN    211 - 280
PNTSIPYAITASLVICLTAYVSVSVILTLMVPYYTIDTESPLMEMFVAHGFYAAKFVVAIGSVAGLTVSL    281 - 350
LGSLFPMPRVIYAMAGDGLLFRFLAHVSSYTETPVVACIVSGFLAALLALLVSLRDLIEMMSIGTLLAYT    351 - 420
LVSVCVLLLRYQPESDIDGFVKFLSEEHTKKKEGILADCEKEACSPVSEGDEFSGPATNTCGAKNLPSLG    421 - 490
DNEMLIGKSDKSTYNVNHPNYGTVDMTTGIEADESENIYLIKLKKLIGPHYYTMRIRLGLPGKMDRPTAA    491 - 560
TGHTVTICVLLLFILMFIFCSFIIFGSDYISEQSWWAILLVVLMVLLISTLVFVILQQPENPKKLPYMAP    561 - 630
CLPFVPAFAMLVNIYLMLKLSTITWIRFAVWCFVGLLIYFGYGIWNSTLEISAREEALHQSTYQRYDVDD    631 - 700
PFSVEEGFSYATEGESQEDWGGPTEDKGFYYQQMSDAKANGRTSSKAKSKSKHKQNSEALIANDELDYSP    701 - 770
E//

Text Mined References (11)

PMID Year Title