Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.52
PubTator Score 2.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 7.51833543714806E-19
atypical teratoid / rhabdoid tumor 4369 1.25464847293773E-13
lung carcinoma 2844 8.05038589995521E-12
oligodendroglioma 2849 2.97731496342303E-9
pilocytic astrocytoma 3086 3.03609435670351E-8
pediatric high grade glioma 2712 2.91097072053841E-7
glioblastoma 5572 4.02379576418875E-6
medulloblastoma, large-cell 6234 6.38226058170559E-5
pituitary cancer 1972 3.03312463596196E-4
astrocytic glioma 2241 0.0012463865601126
primitive neuroectodermal tumor 3031 0.00213871626655426
sonic hedgehog group medulloblastoma 1482 0.00337828001764153
Pick disease 1893 0.0236584186075637
subependymal giant cell astrocytoma 2287 0.0496298062959877
Disease Target Count Z-score Confidence
Lysinuric protein intolerance 15 3.811 1.9
Cystinuria 18 3.229 1.6

Expression

  Differential Expression (14)

Synonym

Accession Q8TBB6 B3KV33 Q9HCF9
Symbols PPP1R142

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
24670872 Data suggests that cationic transporter SLC7A14 has an important role in retinal development and visual function.
22787143 A chimera carrying the functional domain of the orphan protein SLC7A14 in the backbone of SLC7A2 mediates trans-stimulated arginine transport.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSGFFTSLDPRRVQWGAAWYAMHSRILRTKPVESMLEGTGTTTAHGTKLAQVLTTVDLISLGVGSCVGTG      1 - 70
MYVVSGLVAKEMAGPGVIVSFIIAAVASILSGVCYAEFGVRVPKTTGSAYTYSYVTVGEFVAFFIGWNLI     71 - 140
LEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGLGKGEESYPDLLALLIAVIVTIIVALGVKNS    141 - 210
IGFNNVLNVLNLAVWVFIMIAGLFFINGKYWAEGQFLPHGWSGVLQGAATCFYAFIGFDIIATTGEEAKN    211 - 280
PNTSIPYAITASLVICLTAYVSVSVILTLMVPYYTIDTESPLMEMFVAHGFYAAKFVVAIGSVAGLTVSL    281 - 350
LGSLFPMPRVIYAMAGDGLLFRFLAHVSSYTETPVVACIVSGFLAALLALLVSLRDLIEMMSIGTLLAYT    351 - 420
LVSVCVLLLRYQPESDIDGFVKFLSEEHTKKKEGILADCEKEACSPVSEGDEFSGPATNTCGAKNLPSLG    421 - 490
DNEMLIGKSDKSTYNVNHPNYGTVDMTTGIEADESENIYLIKLKKLIGPHYYTMRIRLGLPGKMDRPTAA    491 - 560
TGHTVTICVLLLFILMFIFCSFIIFGSDYISEQSWWAILLVVLMVLLISTLVFVILQQPENPKKLPYMAP    561 - 630
CLPFVPAFAMLVNIYLMLKLSTITWIRFAVWCFVGLLIYFGYGIWNSTLEISAREEALHQSTYQRYDVDD    631 - 700
PFSVEEGFSYATEGESQEDWGGPTEDKGFYYQQMSDAKANGRTSSKAKSKSKHKQNSEALIANDELDYSP    701 - 770
E//

Text Mined References (10)

PMID Year Title
24670872 2014 SLC7A14 linked to autosomal recessive retinitis pigmentosa.
22787143 2012 A chimera carrying the functional domain of the orphan protein SLC7A14 in the backbone of SLC7A2 mediates trans-stimulated arginine transport.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.