Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.72
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.7e-05
group 4 medulloblastoma -1.100 1.6e-03
medulloblastoma, large-cell 1.200 3.6e-04
osteosarcoma -1.546 1.2e-06
psoriasis 1.800 5.8e-05

Gene RIF (1)

AA Sequence

MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKRTQTVELPCPPPSPRLNASLS      1 - 70
VHPEKDELILFGGEYFNGQKTFLYNELYVYNTRKDTWTKVDIPSPPPRRCAHQAVVVPQGGGQLWVFGGE     71 - 140
FASPNGEQFYHYKDLWVLHLATKTWEQVKSTGGPSGRSGHRMVAWKRQLILFGGFHESTRDYIYYNDVYA    141 - 210
FNLDTFTWSKLSPSGTGPTPRSGCQMSVTPQGGIVVYGGYSKQRVKKDVDKGTRHSDMFLLKPEDGREDK    211 - 280
WVWTRMNPSGVKPTPRSGFSVAMAPNHQTLFFGGVCDEEEEESLSGEFFNDLYFYDATRNRWFEGQLKGP    281 - 350
KSEKKKRRRGRKEEPEGGSRPACGGAGTQGPVQLVKEVVAEDGTVVTIKQVLTAPGSAGQPRSEDEDSLE    351 - 420
EAGSPAPGPCPRSNAMLAVKHGVLYVYGGMFEAGDRQVTLSDLHCLDLHRMEAWKALVEMDPETQEWLEE    421 - 490
TDSEEDSEEVEGAEGGVDDEDSGEESGAED                                            491 - 520
//

Text Mined References (16)

PMID Year Title