Property Summary

NCBI Gene PubMed Count 35
Grant Count 2
Funding $150,798.48
PubMed Score 90.16
PubTator Score 32.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -3.500 0.003
ependymoma -3.700 0.001
oligodendroglioma -3.200 0.008
glioblastoma -3.000 0.004
medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -3.100 0.001
Atopic dermatitis -1.200 0.000
non-small cell lung cancer 1.090 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.003
interstitial cystitis -2.200 0.000
pediatric high grade glioma -2.100 0.008
pilocytic astrocytoma -1.400 0.001
nasopharyngeal carcinoma -1.300 0.007
lung carcinoma 1.400 0.000
spina bifida -2.474 0.044
gastric carcinoma -1.300 0.035
ovarian cancer 1.100 0.016

Synonym

Accession Q8TBB1 Q4W5K7 Q8N4C2 Q96MJ7 Q9BY20
Symbols LNX
MPDZ
PDZRN2

Gene

 Grant Application (2)

PDB

3B76  

Gene RIF (17)

PMID Text
22889411 LNX1-mediated ubiquitination and degradation of PBK inhibited cell proliferation and enhanced sensitivity to doxorubicin-induced apoptosis.
22087225 identify and confirm six novel LNX1 binding partners: KCNA4, PAK6, PLEKHG5, PKC-alpha1, TYK2 and PBK, and suggest that LNX1 functions as a signalling scaffold.
22066909 The authors found a high level of LNX1 and LNX2 mRNAs in endocarditis, the principal manifestation of chronic Q fever, but not in acute Q fever.
22045731 LNX1 and LNX2 interact with CD8alpha and promote its ubiquitylation and endocytosis
21104141 Down-regulation of LNX could result in cell cycle arrest in G0/G1 phase through inhibition of beta-catenin, MAPK, NFkappaB, c-Myc-dependent pathway and activation of p53, TGF-beta-dependent pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19701800 LNX and RhoC might be part of a larger protein complex that would have important functions in signaling transduction about regulating the transcriptional activities of AP-1.
19132087 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18940473 Both gene sequence alterations and amplifications of LNX1 and Numbl are present in a subset of human gliomas.
18940473 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNQPESANDPEPLCAVCGQAHSLEENHFYSYPEEVDDDLICHICLQALLDPLDTPCGHTYCTLCLTNFLV      1 - 70
EKDFCPMDRKPLVLQHCKKSSILVNKLLNKLLVTCPFREHCTQVLQRCDLEHHFQTSCKGASHYGLTKDR     71 - 140
KRRSQDGCPDGCASLTATAPSPEVSAAATISLMTDEPGLDNPAYVSSAEDGQPAISPVDSGRSNRTRARP    141 - 210
FERSTIRSRSFKKINRALSVLRRTKSGSAVANHADQGRENSENTTAPEVFPRLYHLIPDGEITSIKINRV    211 - 280
DPSESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQV    281 - 350
LWLTVMREQKFRSRNNGQAPDAYRPRDDSFHVILNKSSPEEQLGIKLVRKVDEPGVFIFNVLDGGVAYRH    351 - 420
GQLEENDRVLAINGHDLRYGSPESAAHLIQASERRVHLVVSRQVRQRSPDIFQEAGWNSNGSWSPGPGER    421 - 490
SNTPKPLHPTITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLN    491 - 560
VDGVELTEVSRSEAVALLKRTSSSIVLKALEVKEYEPQEDCSSPAALDSNHNMAPPSDWSPSWVMWLELP    561 - 630
RCLYNCKDIVLRRNTAGSLGFCIVGGYEEYNGNKPFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGM    631 - 700
IHACLARLLKELKGRITLTIVSWPGTFL                                              701 - 728
//

Text Mined References (38)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22889411 2012 Proteomics strategy to identify substrates of LNX, a PDZ domain-containing E3 ubiquitin ligase.
22087225 2011 Biochemical and computational analysis of LNX1 interacting proteins.
22066909 2012 The ligands of Numb proteins X1 and X2 are specific markers for chronic Q fever.
22045731 2011 Ligand of Numb proteins LNX1p80 and LNX2 interact with the human glycoprotein CD8? and promote its ubiquitylation and endocytosis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...