Property Summary

NCBI Gene PubMed Count 35
PubMed Score 90.16
PubTator Score 32.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 7.77127184052709E-25
atypical teratoid / rhabdoid tumor 4369 1.85818306799037E-9
medulloblastoma 1524 3.35703152265583E-6
non-small cell lung cancer 2798 3.95103075686789E-6
interstitial cystitis 2299 1.17517740118762E-4
Atopic dermatitis 944 1.27322269702842E-4
medulloblastoma, large-cell 6234 1.9689750275727E-4
pilocytic astrocytoma 3086 7.79237644412827E-4
primitive neuroectodermal tumor 3031 0.00100985616884408
ependymoma 2514 0.0011013527388007
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00310238839341511
astrocytic glioma 2241 0.00336549832584724
glioblastoma 5572 0.00367363242491969
nasopharyngeal carcinoma 1056 0.00692234582480193
oligodendroglioma 2849 0.00774462517149997
pediatric high grade glioma 2712 0.00810180953454888
ovarian cancer 8492 0.0164697532547609
gastric carcinoma 832 0.0354272301300288
spina bifida 1064 0.0439001711556207
Disease Target Count Z-score Confidence
Alcohol dependence 107 3.894 1.9
Keratoconus 49 3.802 1.9

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -3.500 0.003
ependymoma -3.700 0.001
oligodendroglioma -3.200 0.008
glioblastoma -3.000 0.004
medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -3.100 0.001
Atopic dermatitis -1.200 0.000
non-small cell lung cancer 1.090 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.003
interstitial cystitis -2.200 0.000
pediatric high grade glioma -2.100 0.008
pilocytic astrocytoma -1.400 0.001
nasopharyngeal carcinoma -1.300 0.007
lung carcinoma 1.400 0.000
spina bifida -2.474 0.044
gastric carcinoma -1.300 0.035
ovarian cancer 1.100 0.016

Synonym

Accession Q8TBB1 Q4W5K7 Q8N4C2 Q96MJ7 Q9BY20
Symbols LNX
MPDZ
PDZRN2

Gene

PDB

3B76  

  Ortholog (12)

Gene RIF (17)

PMID Text
22889411 LNX1-mediated ubiquitination and degradation of PBK inhibited cell proliferation and enhanced sensitivity to doxorubicin-induced apoptosis.
22087225 identify and confirm six novel LNX1 binding partners: KCNA4, PAK6, PLEKHG5, PKC-alpha1, TYK2 and PBK, and suggest that LNX1 functions as a signalling scaffold.
22066909 The authors found a high level of LNX1 and LNX2 mRNAs in endocarditis, the principal manifestation of chronic Q fever, but not in acute Q fever.
22045731 LNX1 and LNX2 interact with CD8alpha and promote its ubiquitylation and endocytosis
21104141 Down-regulation of LNX could result in cell cycle arrest in G0/G1 phase through inhibition of beta-catenin, MAPK, NFkappaB, c-Myc-dependent pathway and activation of p53, TGF-beta-dependent pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19701800 LNX and RhoC might be part of a larger protein complex that would have important functions in signaling transduction about regulating the transcriptional activities of AP-1.
19132087 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18940473 Both gene sequence alterations and amplifications of LNX1 and Numbl are present in a subset of human gliomas.
18940473 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNQPESANDPEPLCAVCGQAHSLEENHFYSYPEEVDDDLICHICLQALLDPLDTPCGHTYCTLCLTNFLV      1 - 70
EKDFCPMDRKPLVLQHCKKSSILVNKLLNKLLVTCPFREHCTQVLQRCDLEHHFQTSCKGASHYGLTKDR     71 - 140
KRRSQDGCPDGCASLTATAPSPEVSAAATISLMTDEPGLDNPAYVSSAEDGQPAISPVDSGRSNRTRARP    141 - 210
FERSTIRSRSFKKINRALSVLRRTKSGSAVANHADQGRENSENTTAPEVFPRLYHLIPDGEITSIKINRV    211 - 280
DPSESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQV    281 - 350
LWLTVMREQKFRSRNNGQAPDAYRPRDDSFHVILNKSSPEEQLGIKLVRKVDEPGVFIFNVLDGGVAYRH    351 - 420
GQLEENDRVLAINGHDLRYGSPESAAHLIQASERRVHLVVSRQVRQRSPDIFQEAGWNSNGSWSPGPGER    421 - 490
SNTPKPLHPTITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLN    491 - 560
VDGVELTEVSRSEAVALLKRTSSSIVLKALEVKEYEPQEDCSSPAALDSNHNMAPPSDWSPSWVMWLELP    561 - 630
RCLYNCKDIVLRRNTAGSLGFCIVGGYEEYNGNKPFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGM    631 - 700
IHACLARLLKELKGRITLTIVSWPGTFL                                              701 - 728
//

Text Mined References (38)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22889411 2012 Proteomics strategy to identify substrates of LNX, a PDZ domain-containing E3 ubiquitin ligase.
22087225 2011 Biochemical and computational analysis of LNX1 interacting proteins.
22066909 2012 The ligands of Numb proteins X1 and X2 are specific markers for chronic Q fever.
22045731 2011 Ligand of Numb proteins LNX1p80 and LNX2 interact with the human glycoprotein CD8? and promote its ubiquitylation and endocytosis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...