Property Summary

NCBI Gene PubMed Count 38
PubMed Score 97.94
PubTator Score 32.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -2.100 1.2e-02
astrocytic glioma -3.500 3.4e-03
Astrocytoma, Pilocytic -1.300 9.3e-04
Atopic dermatitis -1.200 1.3e-04
atypical teratoid / rhabdoid tumor -4.200 1.9e-09
ependymoma -3.700 1.1e-03
gastric carcinoma -1.300 3.5e-02
glioblastoma -1.400 1.1e-03
group 3 medulloblastoma -1.700 1.2e-02
interstitial cystitis -2.000 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.1e-03
lung carcinoma 1.400 7.8e-25
medulloblastoma, large-cell -4.000 2.0e-04
nasopharyngeal carcinoma -1.300 6.9e-03
non-small cell lung cancer 1.090 4.0e-06
oligodendroglioma -3.200 7.7e-03
ovarian cancer 1.100 1.6e-02
primitive neuroectodermal tumor -3.100 1.0e-03
spina bifida -2.474 4.4e-02

Protein-protein Interaction (3)

Gene RIF (18)

AA Sequence

MNQPESANDPEPLCAVCGQAHSLEENHFYSYPEEVDDDLICHICLQALLDPLDTPCGHTYCTLCLTNFLV      1 - 70
EKDFCPMDRKPLVLQHCKKSSILVNKLLNKLLVTCPFREHCTQVLQRCDLEHHFQTSCKGASHYGLTKDR     71 - 140
KRRSQDGCPDGCASLTATAPSPEVSAAATISLMTDEPGLDNPAYVSSAEDGQPAISPVDSGRSNRTRARP    141 - 210
FERSTIRSRSFKKINRALSVLRRTKSGSAVANHADQGRENSENTTAPEVFPRLYHLIPDGEITSIKINRV    211 - 280
DPSESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQV    281 - 350
LWLTVMREQKFRSRNNGQAPDAYRPRDDSFHVILNKSSPEEQLGIKLVRKVDEPGVFIFNVLDGGVAYRH    351 - 420
GQLEENDRVLAINGHDLRYGSPESAAHLIQASERRVHLVVSRQVRQRSPDIFQEAGWNSNGSWSPGPGER    421 - 490
SNTPKPLHPTITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLN    491 - 560
VDGVELTEVSRSEAVALLKRTSSSIVLKALEVKEYEPQEDCSSPAALDSNHNMAPPSDWSPSWVMWLELP    561 - 630
RCLYNCKDIVLRRNTAGSLGFCIVGGYEEYNGNKPFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGM    631 - 700
IHACLARLLKELKGRITLTIVSWPGTFL                                              701 - 728
//

Text Mined References (41)

PMID Year Title