Property Summary

NCBI Gene PubMed Count 9
PubMed Score 25.63
PubTator Score 6.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-03
Alzheimer's disease -1.400 3.0e-02
astrocytic glioma -1.200 3.4e-02
atypical teratoid / rhabdoid tumor -2.200 1.6e-05
Breast cancer 2.300 4.5e-02
ependymoma -1.200 4.7e-02
glioblastoma -1.600 1.6e-05
group 3 medulloblastoma -1.400 4.8e-02
intraductal papillary-mucinous adenoma (... 1.700 4.6e-04
intraductal papillary-mucinous carcinoma... 1.500 2.9e-03
intraductal papillary-mucinous neoplasm ... 1.700 1.2e-03
lung carcinoma 1.100 7.8e-28
malignant mesothelioma -1.100 4.1e-06
medulloblastoma, large-cell -2.600 5.2e-04
oligodendroglioma -1.200 1.1e-11
osteosarcoma -1.177 9.4e-03
ovarian cancer -1.300 3.5e-05
pancreatic ductal adenocarcinoma liver m... -1.669 1.0e-02
Parkinson's disease -1.100 4.6e-02
Pick disease -1.900 7.2e-05
pituitary cancer 1.100 1.0e-03
primitive neuroectodermal tumor -1.300 2.6e-03

Synonym

Accession Q8TB96 Q96SR4 Q9BRE2 Q9H2V9 Protein TIP
Symbols TIP
CDA08
LNKN-1
2310047C21Rik

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAAAGRLPSSWALFSPLLAGLALLGVGPVPARALHNVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLRER      1 - 70
NDLIVFLADQNAPYFKPKVKVSFKNHSALITSVVPGDYDGDSQMDVLLTYLPKNYAKSELGAVIFWGQNQ     71 - 140
TLDPNNMTILNRTFQDEPLIMDFNGDLIPDIFGITNESNQPQILLGGNLSWHPALTTTSKMRIPHSHAFI    141 - 210
DLTEDFTADLFLTTLNATTSTFQFEIWENLDGNFSVSTILEKPQNMMVVGQSAFADFDGDGHMDHLLPGC    211 - 280
EDKNCQKSTIYLVRSGMKQWVPVLQDFSNKGTLWGFVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVI    281 - 350
LKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYT    351 - 420
KNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQ    421 - 490
SAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLY    491 - 560
LTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKADDREKRQEAHRFHFDAM                      561 - 612
//

Text Mined References (10)

PMID Year Title