Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.71
PubTator Score 6.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
lung carcinoma 2844 7.8088555826452E-28
oligodendroglioma 2849 1.13242493786822E-11
ovarian cancer 8492 4.86657622127197E-7
malignant mesothelioma 3163 4.10576442988264E-6
atypical teratoid / rhabdoid tumor 4369 1.6140623953777E-5
glioblastoma 5572 2.18603364943188E-5
Pick disease 1893 7.19307198300509E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.56158915039007E-4
medulloblastoma, large-cell 6234 5.24933666050073E-4
pituitary cancer 1972 9.95288474971955E-4
medulloblastoma 1524 0.00103049043982997
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00124250812134288
adult high grade glioma 2148 0.00170626775177258
primitive neuroectodermal tumor 3031 0.00262710056584686
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0029151985219394
astrocytic glioma 2241 0.00736677877517677
ependymoma 2514 0.00893139979465131
osteosarcoma 7933 0.0094458445759387
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0103396695146405
Alzheimer's disease 644 0.0302351879633385
Breast cancer 3099 0.0454514202621798
Parkinson's disease 364 0.0463467219979555
Disease Target Count Z-score Confidence
Tethered spinal cord syndrome 12 4.938 2.5
Echinococcosis 28 3.257 1.6

Expression

Synonym

Accession Q8TB96 Q96SR4 Q9BRE2 Q9H2V9 Protein TIP
Symbols TIP
CDA08
LNKN-1
2310047C21Rik

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17384681 Alterations in the cellular levels of TIP influence the phosphorylation state of a specific protein substrate of ataxia-telangiectasia mutated (ATM)/ATM- and Rad3-related (ATR) kinases.

AA Sequence

MAAAGRLPSSWALFSPLLAGLALLGVGPVPARALHNVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLRER      1 - 70
NDLIVFLADQNAPYFKPKVKVSFKNHSALITSVVPGDYDGDSQMDVLLTYLPKNYAKSELGAVIFWGQNQ     71 - 140
TLDPNNMTILNRTFQDEPLIMDFNGDLIPDIFGITNESNQPQILLGGNLSWHPALTTTSKMRIPHSHAFI    141 - 210
DLTEDFTADLFLTTLNATTSTFQFEIWENLDGNFSVSTILEKPQNMMVVGQSAFADFDGDGHMDHLLPGC    211 - 280
EDKNCQKSTIYLVRSGMKQWVPVLQDFSNKGTLWGFVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVI    281 - 350
LKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYT    351 - 420
KNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQ    421 - 490
SAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLY    491 - 560
LTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKADDREKRQEAHRFHFDAM                      561 - 612
//

Text Mined References (9)

PMID Year Title
25437307 2014 LINKIN, a new transmembrane protein necessary for cell adhesion.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17384681 2007 Identification of a PP2A-interacting protein that functions as a negative regulator of phosphatase activity in the ATM/ATR signaling pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12598909 2003 TIP, a T-cell factor identified using high-throughput screening increases survival in a graft-versus-host disease model.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.