Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.17
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 1.7e-02
Astrocytoma, Pilocytic -1.300 7.9e-04
atypical teratoid / rhabdoid tumor -2.400 2.5e-09
ependymoma -1.200 1.1e-02
glioblastoma -1.100 1.1e-03
group 3 medulloblastoma 1.600 4.5e-02
medulloblastoma, large-cell -2.600 5.2e-05
osteosarcoma -1.447 1.8e-02
pituitary cancer 1.100 9.1e-04
primitive neuroectodermal tumor -1.200 1.6e-02
subependymal giant cell astrocytoma -1.510 2.7e-02

Gene RIF (1)

AA Sequence

MELLTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLVSLAVYSYYNQGILPEQGIQDSFKKATLGR      1 - 70
YGSCGLENICLWKNWESIGEGEGQKECYNLCSQYLTTSHNKHLTVKGDKEYRIFQKKPQFLSAAPTEPCI     71 - 140
PMNKYQHKFLKSVFCNKNQINFNHDSNISKHHSTHFLENYYNCNECEKVFYQSSKLIFPENIHIQKKPYN    141 - 210
SNECGETSDPFSKLTQHQRIYIGESSQRCNKKCIIVFSQSHLKGHKIINTGEKSVKYKERGKAFTRGLHL    211 - 280
GHQKIHTGEKPYKCKKCDKAFNKSSHLAQHQRIHTGEKPFKCKECGKAFNRGSYLTQHQRIHTGERAFKC    281 - 350
EECGKAFNRGSYLTQHQRIHTGEKPFRCKECGKAFNRSSYVTQHQRMHTGEKPFKCKECGKAFNRASHLT    351 - 420
QHQRIHTGEKHFKCKECGKAFNRGSHLTRHQRIHTGEKSFKCEECGKAFIWGSHLTQHQRVHTGEKFFKC    421 - 490
KECGKAFTRSSHLTQHQRIHTGEKPFKCKECGKAFNRRSTLTQHQIIHTR                        491 - 540
//

Text Mined References (6)

PMID Year Title