Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.49
PubTator Score 0.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 2.0e-13
osteosarcoma 7950 1.1e-04
fibroadenoma 559 1.7e-02
Disease Target Count Z-score Confidence
Cataract 7 32 4.254 2.1

Expression

  Differential Expression (3)

Disease log2 FC p
fibroadenoma 1.100 1.7e-02
lung adenocarcinoma 1.700 2.0e-13
osteosarcoma 1.407 1.1e-04

Gene RIF (2)

AA Sequence

MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPP      1 - 70
GLAPPQPPPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHHALPHPPPTHLSVPPRPWSYP     71 - 140
RQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGY    141 - 210
TSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV          211 - 274
//

Text Mined References (8)

PMID Year Title