Property Summary

NCBI Gene PubMed Count 14
PubMed Score 191.50
PubTator Score 85.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (5)

AA Sequence

MDARWWAVVVLAAFPSLGAGGETPEAPPESWTQLWFFRFVVNAAGYASFMVPGYLLVQYFRRKNYLETGR      1 - 70
GLCFPLVKACVFGNEPKASDEVPLAPRTEAAETTPMWQALKLLFCATGLQVSYLTWGVLQERVMTRSYGA     71 - 140
TATSPGERFTDSQFLVLMNRVLALIVAGLSCVLCKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFP    141 - 210
TQVLAKASKVIPVMLMGKLVSRRSYEHWEYLTATLISIGVSMFLLSSGPEPRSSPATTLSGLILLAGYIA    211 - 280
FDSFTSNWQDALFAYKMSSVQMMFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSAC    281 - 350
GQLFIFYTIGQFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGK    351 - 420
KAVPVESPVQKV                                                              421 - 432
//

Text Mined References (22)

PMID Year Title