Property Summary

NCBI Gene PubMed Count 13
Grant Count 59
R01 Count 9
Funding $6,262,968.92
PubMed Score 177.35
PubTator Score 85.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TB61 B4DDM2 B4DDU9 F5H7Y9 Q2VY06 Q53GA3 Q5T9W1 Q5T9W2 Q7Z2G3 Q8NBK6 Q96AR6
Symbols SLL
PAPST1
UGTrel4

Gene

PANTHER Protein Class (1)

Gene RIF (4)

PMID Text
24576181 Results suggest that frequently downregulated miR-22 expression is associated with cell proliferation in medulloblastomas, and this may be at least in part via PAPST1, which is a novel target of miR-22
20978009 PAPS transporters play a role in the proliferation of colorectal carcinoma cells themselves and take part in a desmoplastic reaction to support cancer growth by controlling their sulfation status.
19773279 Observational study of gene-disease association. (HuGE Navigator)
12716889 PAPS1 has roles in PAPS transport and post-translational sulfation

AA Sequence

MDARWWAVVVLAAFPSLGAGGETPEAPPESWTQLWFFRFVVNAAGYASFMVPGYLLVQYFRRKNYLETGR      1 - 70
GLCFPLVKACVFGNEPKASDEVPLAPRTEAAETTPMWQALKLLFCATGLQVSYLTWGVLQERVMTRSYGA     71 - 140
TATSPGERFTDSQFLVLMNRVLALIVAGLSCVLCKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFP    141 - 210
TQVLAKASKVIPVMLMGKLVSRRSYEHWEYLTATLISIGVSMFLLSSGPEPRSSPATTLSGLILLAGYIA    211 - 280
FDSFTSNWQDALFAYKMSSVQMMFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSAC    281 - 350
GQLFIFYTIGQFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGK    351 - 420
KAVPVESPVQKV                                                              421 - 432
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24576181 2014 MiR-22 is frequently downregulated in medulloblastomas and inhibits cell proliferation via the novel target PAPST1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20978009 2011 Expression and the role of 3'-phosphoadenosine 5'-phosphosulfate transporters in human colorectal carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...