Property Summary

NCBI Gene PubMed Count 38
Grant Count 30
R01 Count 11
Funding $2,400,363.04
PubMed Score 42.29
PubTator Score 31.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
interstitial lung disease -1.100 0.044
malignant mesothelioma -5.400 0.000
osteosarcoma 2.090 0.001
cystic fibrosis -2.759 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma -1.200 0.000
Duchenne muscular dystrophy -1.047 0.000
adrenocortical carcinoma -1.699 0.001
intraductal papillary-mucinous adenoma (... 1.600 0.015
interstitial cystitis -1.400 0.000
aldosterone-producing adenoma -1.480 0.018
lung adenocarcinoma 2.138 0.000
lung carcinoma 1.500 0.000
non-small cell lung carcinoma 1.300 0.000
Breast cancer -1.100 0.002
ovarian cancer 1.800 0.000
pituitary cancer -2.300 0.000

Gene RIF (27)

PMID Text
26717892 Cul1 promoted mTORC1 activity and cap-dependent translation by enhancing the ubiquitination and degradation of DEPTOR.
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
25936805 Data indicate that phosphatidic acid (PA) specifically disrupts DEPTOR-mTORC1 interaction.
25843797 conclude that DEPTOR-related mTOR suppression is involved in metformin's anti-cancer action in liver, and could be a novel target for anti-cancer therapy
25810016 Deptor enhances triple-negative breast cancer metastasis and chemoresistance through coupling to survivin expression
25605718 Receptor CXCR4 signaling promotes lysosomal and ESCRT-dependent degradation of DEPTOR, an antagonist of mTORC2, that regulates Akt activation and signaling.
25544749 Data suggest that DEPTOR has a tumor suppressive activity against pancreatic cancer cells, and its loss of expression may contribute to pancreatic tumorigenesis.
25333702 our data provide evidence for the requirement of TGFbeta-activated mTORC1 only by deptor downregulation, which dominates upon the bystander mTORC2 activity for enhanced expression of collagen I (alpha2).
25258312 DEPTOR plays a key role in maintaining stem cell pluripotency by limiting mTOR activity in undifferentiated embryonic stem cells
25119265 In Alzheimer's disease patients the mTOR pathway can be overactive, leading to a dysfunction of autophagy and a lack of amyloid beta clearance so the excess of amyloid beta will cause a further decrease in DEPTOR and an increase in mTOR expression.
More...

AA Sequence

MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELI      1 - 70
DWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLY     71 - 140
EKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKHPFVD    141 - 210
SNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSS    211 - 280
MSSCGSSGYFSSSPTLSSSPPVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPC    281 - 350
HIQAVDPSGPAAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELEC               351 - 409
//

Text Mined References (45)

PMID Year Title
26717892 2016 Cul1 promotes melanoma cell proliferation by promoting DEPTOR degradation and enhancing cap-dependent translation.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
25936805 2015 Rapid mitogenic regulation of the mTORC1 inhibitor, DEPTOR, by phosphatidic acid.
25843797 2015 DEPTOR-related mTOR suppression is involved in metformin's anti-cancer action in human liver cancer cells.
25810016 2015 Deptor enhances triple-negative breast cancer metastasis and chemoresistance through coupling to survivin expression.
25605718 2015 The endosomal sorting complex required for transport pathway mediates chemokine receptor CXCR4-promoted lysosomal degradation of the mammalian target of rapamycin antagonist DEPTOR.
25544749 2014 DEPTOR has growth suppression activity against pancreatic cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25333702 2014 TGF?-induced deptor suppression recruits mTORC1 and not mTORC2 to enhance collagen I (?2) gene expression.
25258312 2014 DEPTOR is a stemness factor that regulates pluripotency of embryonic stem cells.
More...