Property Summary

NCBI Gene PubMed Count 38
PubMed Score 42.29
PubTator Score 31.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Lung Diseases, Interstitial 15
Disease Target Count P-value
non-small cell lung carcinoma 413 1.58658046719306E-17
malignant mesothelioma 3163 8.34842208176035E-10
lung carcinoma 2844 3.10046265002126E-8
lung adenocarcinoma 2714 1.17896462323616E-6
cystic fibrosis 1670 6.46176429734125E-6
Duchenne muscular dystrophy 602 8.68924472199688E-6
pituitary cancer 1972 3.42654068884554E-5
atypical teratoid / rhabdoid tumor 4369 9.56541053902754E-5
interstitial cystitis 2299 3.24106580592447E-4
ovarian cancer 8492 3.69526380862351E-4
medulloblastoma 1524 4.06830158517587E-4
osteosarcoma 7933 9.87461434471376E-4
adrenocortical carcinoma 1427 0.00134001709221244
Breast cancer 3099 0.00172709903233379
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0152438364685087
aldosterone-producing adenoma 664 0.0182053769159998
Disease Target Count Z-score Confidence
interstitial lung disease 292 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.116 1.6

Expression

  Differential Expression (17)

Disease log2 FC p
interstitial lung disease -1.100 0.044
malignant mesothelioma -5.400 0.000
osteosarcoma 2.090 0.001
cystic fibrosis -2.759 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma -1.200 0.000
Duchenne muscular dystrophy -1.047 0.000
adrenocortical carcinoma -1.699 0.001
intraductal papillary-mucinous adenoma (... 1.600 0.015
interstitial cystitis -1.400 0.000
aldosterone-producing adenoma -1.480 0.018
lung adenocarcinoma 2.138 0.000
lung carcinoma 1.500 0.000
non-small cell lung carcinoma 1.300 0.000
Breast cancer -1.100 0.002
ovarian cancer 1.800 0.000
pituitary cancer -2.300 0.000

Synonym

Accession Q8TB45 B2RCL9 B4DN97 E7EV87 Q96EQ1 Q9H0R7 Q9H894 Q9HA07
Symbols DEP.6
DEPDC6

Gene

  Ortholog (10)

Gene RIF (27)

PMID Text
26717892 Cul1 promoted mTORC1 activity and cap-dependent translation by enhancing the ubiquitination and degradation of DEPTOR.
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
25936805 Data indicate that phosphatidic acid (PA) specifically disrupts DEPTOR-mTORC1 interaction.
25843797 conclude that DEPTOR-related mTOR suppression is involved in metformin's anti-cancer action in liver, and could be a novel target for anti-cancer therapy
25810016 Deptor enhances triple-negative breast cancer metastasis and chemoresistance through coupling to survivin expression
25605718 Receptor CXCR4 signaling promotes lysosomal and ESCRT-dependent degradation of DEPTOR, an antagonist of mTORC2, that regulates Akt activation and signaling.
25544749 Data suggest that DEPTOR has a tumor suppressive activity against pancreatic cancer cells, and its loss of expression may contribute to pancreatic tumorigenesis.
25333702 our data provide evidence for the requirement of TGFbeta-activated mTORC1 only by deptor downregulation, which dominates upon the bystander mTORC2 activity for enhanced expression of collagen I (alpha2).
25258312 DEPTOR plays a key role in maintaining stem cell pluripotency by limiting mTOR activity in undifferentiated embryonic stem cells
25119265 In Alzheimer's disease patients the mTOR pathway can be overactive, leading to a dysfunction of autophagy and a lack of amyloid beta clearance so the excess of amyloid beta will cause a further decrease in DEPTOR and an increase in mTOR expression.
More...

AA Sequence

MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELI      1 - 70
DWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLY     71 - 140
EKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKHPFVD    141 - 210
SNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSS    211 - 280
MSSCGSSGYFSSSPTLSSSPPVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPC    281 - 350
HIQAVDPSGPAAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELEC               351 - 409
//

Text Mined References (45)

PMID Year Title
26717892 2016 Cul1 promotes melanoma cell proliferation by promoting DEPTOR degradation and enhancing cap-dependent translation.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
25936805 2015 Rapid mitogenic regulation of the mTORC1 inhibitor, DEPTOR, by phosphatidic acid.
25843797 2015 DEPTOR-related mTOR suppression is involved in metformin's anti-cancer action in human liver cancer cells.
25810016 2015 Deptor enhances triple-negative breast cancer metastasis and chemoresistance through coupling to survivin expression.
25605718 2015 The endosomal sorting complex required for transport pathway mediates chemokine receptor CXCR4-promoted lysosomal degradation of the mammalian target of rapamycin antagonist DEPTOR.
25544749 2014 DEPTOR has growth suppression activity against pancreatic cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25333702 2014 TGF?-induced deptor suppression recruits mTORC1 and not mTORC2 to enhance collagen I (?2) gene expression.
25258312 2014 DEPTOR is a stemness factor that regulates pluripotency of embryonic stem cells.
More...