Property Summary

NCBI Gene PubMed Count 48
PubMed Score 50.19
PubTator Score 31.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
interstitial lung disease -1.100 4.4e-02
adrenocortical carcinoma -1.699 1.3e-03
aldosterone-producing adenoma -1.480 1.8e-02
atypical teratoid / rhabdoid tumor -1.100 9.6e-05
Breast cancer -1.100 1.7e-03
cystic fibrosis -2.759 6.5e-06
Duchenne muscular dystrophy -1.047 8.7e-06
interstitial cystitis -1.200 1.5e-02
intraductal papillary-mucinous adenoma (... 1.600 1.5e-02
lung adenocarcinoma 1.200 1.8e-05
lung carcinoma 1.500 3.1e-08
malignant mesothelioma -5.400 8.3e-10
medulloblastoma -1.200 4.1e-04
non-small cell lung carcinoma 1.300 1.6e-17
osteosarcoma 2.090 9.9e-04
ovarian cancer 1.800 3.7e-04
pituitary cancer -2.300 3.4e-05

Gene RIF (37)

AA Sequence

MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELI      1 - 70
DWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLY     71 - 140
EKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKHPFVD    141 - 210
SNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSS    211 - 280
MSSCGSSGYFSSSPTLSSSPPVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPC    281 - 350
HIQAVDPSGPAAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELEC               351 - 409
//

Text Mined References (55)

PMID Year Title