Property Summary

NCBI Gene PubMed Count 6
Grant Count 7
Funding $351,475.16
PubMed Score 3.46
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma 1.100 0.003
glioblastoma 1.300 0.000
lung cancer 1.300 0.001
posterior fossa group A ependymoma 1.100 0.000
subependymal giant cell astrocytoma 1.277 0.007

Gene RIF (2)

PMID Text
22488300 ABHD4 is a novel genetic regulator of anoikis sensitivity.
16818490 Lysophospholipase/phospholipase B (EC 3.1.1.5) specific for N-acyl phosphatidylethanolamine (NAPE) suggesting a role in the biosynthesis of N-acyl ethanolamines including the endocannabinoid anandamide.

AA Sequence

MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTP      1 - 70
LVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSM     71 - 140
ILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVA    141 - 210
GPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKD    211 - 280
VPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD            281 - 342
//

Text Mined References (7)

PMID Year Title
22488300 2012 A genome wide shRNA screen identifies ?/? hydrolase domain containing 4 (ABHD4) as a novel regulator of anoikis resistance.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16818490 2006 Endocannabinoid biosynthesis proceeding through glycerophospho-N-acyl ethanolamine and a role for alpha/beta-hydrolase 4 in this pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.