Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.87
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.200 0.000
psoriasis -1.400 0.000
medulloblastoma, large-cell -1.600 0.004
adrenocortical carcinoma -1.067 0.013
pancreatic ductal adenocarcinoma liver m... 1.102 0.010
lung cancer -1.200 0.019
sonic hedgehog group medulloblastoma -1.600 0.000
ovarian cancer 1.800 0.000

Gene RIF (1)

PMID Text
23118872 SSP411 has potential as a biomarker for the diagnosis of Cholangiocarcinoma

AA Sequence

MLGARAWLGRVLLLPRAGAGLAASRRGSSSRDKDRSATVSSSVPMPAGGKGSHPSSTPQRVPNRLIHEKS      1 - 70
PYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLSEDFVSVKVD     71 - 140
REERPDVDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGGTYFPPEDGLTRVGFRTVLLRIREQWKQNKN    141 - 210
TLLENSQRVTTALLARSEISVGDRQLPPSAATVNNRCFQQLDEGYDEEYGGFAEAPKFPTPVILSFLFSY    211 - 280
WLSHRLTQDGSRAQQMALHTLKMMANGGIRDHVGQGFHRYSTDRQWHVPHFEKMLYDQAQLAVAYSQAFQ    281 - 350
LSGDEFYSDVAKGILQYVARSLSHRSGGFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGAT    351 - 420
EPLTSGQLLMKHYGLTEAGNISPSQDPKGELQGQNVLTVRYSLELTAARFGLDVEAVRTLLNSGLEKLFQ    421 - 490
ARKHRPKPHLDSKMLAAWNGLMVSGYAVTGAVLGQDRLINYATNGAKFLKRHMFDVASGRLMRTCYTGPG    491 - 560
GTVEHSNPPCWGFLEDYAFVVRGLLDLYEASQESAWLEWALRLQDTQDKLFWDSQGGGYFCSEAELGAGL    561 - 630
PLRLKDDQDGAEPSANSVSAHNLLRLHGFTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAQQQT    631 - 700
LKQIVICGDRQAKDTKALVQCVHSVYIPNKVLILADGDPSSFLSRQLPFLSTLRRLEDQATAYVCENQAC    701 - 770
SVPITDPCELRKLLHP                                                          771 - 786
//

Text Mined References (10)

PMID Year Title
23118872 2012 Comparative proteomic profiling of human bile reveals SSP411 as a novel biomarker of cholangiocarcinoma.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15223837 Cloning and characterization of rat spermatid protein SSP411: a thioredoxin-like protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.