Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.13
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma -1.067 1.3e-02
lung cancer -1.200 1.9e-02
malignant mesothelioma -2.200 1.2e-07
medulloblastoma, large-cell -1.600 4.4e-03
ovarian cancer 1.800 7.0e-06
pancreatic ductal adenocarcinoma liver m... 1.102 1.0e-02
psoriasis -1.400 1.5e-07
sonic hedgehog group medulloblastoma -1.600 3.3e-06

Gene RIF (1)

AA Sequence

MLGARAWLGRVLLLPRAGAGLAASRRGSSSRDKDRSATVSSSVPMPAGGKGSHPSSTPQRVPNRLIHEKS      1 - 70
PYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLSEDFVSVKVD     71 - 140
REERPDVDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGGTYFPPEDGLTRVGFRTVLLRIREQWKQNKN    141 - 210
TLLENSQRVTTALLARSEISVGDRQLPPSAATVNNRCFQQLDEGYDEEYGGFAEAPKFPTPVILSFLFSY    211 - 280
WLSHRLTQDGSRAQQMALHTLKMMANGGIRDHVGQGFHRYSTDRQWHVPHFEKMLYDQAQLAVAYSQAFQ    281 - 350
LSGDEFYSDVAKGILQYVARSLSHRSGGFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGAT    351 - 420
EPLTSGQLLMKHYGLTEAGNISPSQDPKGELQGQNVLTVRYSLELTAARFGLDVEAVRTLLNSGLEKLFQ    421 - 490
ARKHRPKPHLDSKMLAAWNGLMVSGYAVTGAVLGQDRLINYATNGAKFLKRHMFDVASGRLMRTCYTGPG    491 - 560
GTVEHSNPPCWGFLEDYAFVVRGLLDLYEASQESAWLEWALRLQDTQDKLFWDSQGGGYFCSEAELGAGL    561 - 630
PLRLKDDQDGAEPSANSVSAHNLLRLHGFTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAQQQT    631 - 700
LKQIVICGDRQAKDTKALVQCVHSVYIPNKVLILADGDPSSFLSRQLPFLSTLRRLEDQATAYVCENQAC    701 - 770
SVPITDPCELRKLLHP                                                          771 - 786
//

Text Mined References (10)

PMID Year Title