Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
posterior fossa group B ependymoma 416 2.8e-06

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma -1.100 2.8e-06

AA Sequence

MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQMMCTPANTPA      1 - 70
TPPNFPDALTMFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQ     71 - 140
PPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER                                     141 - 177
//

Text Mined References (6)

PMID Year Title