Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.98
PubTator Score 6.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count P-value
non-small cell lung cancer 2890 3.7e-15
lung adenocarcinoma 2716 2.0e-14
tuberculosis 2010 2.2e-03
ulcerative colitis 1819 3.6e-03
osteosarcoma 7950 4.9e-03
Disease Target Count Z-score Confidence
Varicocele 26 4.333 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma -1.200 2.0e-14
non-small cell lung cancer -1.582 3.7e-15
osteosarcoma -2.768 4.9e-03
tuberculosis 1.100 2.2e-03
ulcerative colitis 1.400 3.6e-03

Gene RIF (6)

AA Sequence

MAPKAAKGAKPEPAPAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRR      1 - 70
YRWELKDSNKEFWLLGHAEIKIRSLGCLIAAMILLSSLTVHPILRLIITMEISFFSFFILLYSFAIHRYI     71 - 140
PFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMNLHYLLAVILIGAAGVFAFIDVCLQRNHFRGKKAKK    141 - 210
HMLVPPPGKEKGPQQGKGPEPAKPPEPGKPPGPAKGKK                                    211 - 248
//

Text Mined References (11)

PMID Year Title