Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.28
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.768 0.005
tuberculosis 1.100 0.002
non-small cell lung cancer -1.582 0.000
lung adenocarcinoma -1.200 0.000
ulcerative colitis 1.400 0.004

Synonym

Accession Q8TAZ6 Q5I2A4 Q8N7E5
Symbols CKLFSF2

Gene

Gene RIF (6)

PMID Text
22901147 Aberrant DNA methylation of CMTM2 gene is associated with colorectal cancer.
21034562 Intracellular CMTM2 can negatively regulate HIV-1 transcription, at least in part, by targeting the AP-1 and CREB pathways.
21034562 The CKLF-like MARVEL transmembrane domain-containing family 2 (CMTM2) inhibits HIV-1 Tat-induced AP-1 and CREB activation, which leads to suppression of HIV-1 provirus transcription
17334588 CKLFSF2 was specifically expressed in meiotic and post-meiotic germ cells, which were localized to the endoplasmic reticulum (ER) near the Golgi apparatus.
15778092 novel evidence that the final intron/exon region of the CKLFSF1 gene contains a novel eukaryotic promoter capable of directing expression of the downstream gene, CKLFSF2
12782130 Bioinformatics based on CKLF2 cDNA and protein sequences in combination with experimental validation identified CKLFSF1-8 gene clusters, between the SCY and the TM4SF gene families. The 8 family members were cloned and characterized.

AA Sequence

MAPKAAKGAKPEPAPAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRR      1 - 70
YRWELKDSNKEFWLLGHAEIKIRSLGCLIAAMILLSSLTVHPILRLIITMEISFFSFFILLYSFAIHRYI     71 - 140
PFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMNLHYLLAVILIGAAGVFAFIDVCLQRNHFRGKKAKK    141 - 210
HMLVPPPGKEKGPQQGKGPEPAKPPEPGKPPGPAKGKK                                    211 - 248
//

Text Mined References (11)

PMID Year Title
22901147 2012 Genome-wide analysis of aberrant DNA methylation for identification of potential biomarkers in colorectal cancer patients.
21034562 2010 Intracellular CMTM2 negatively regulates human immunodeficiency virus type-1 transcription through targeting the transcription factors AP-1 and CREB.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17334588 2007 Expression and localization of CKLFSF2 in human spermatogenesis.
15896670 2005 CKLFSF2 is highly expressed in testis and can be secreted into the seminiferous tubules.
15778092 2005 A functional promoter region of the CKLFSF2 gene is located in the last intron/exon region of the upstream CKLFSF1 gene.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12782130 2003 Identification of eight genes encoding chemokine-like factor superfamily members 1-8 (CKLFSF1-8) by in silico cloning and experimental validation.
More...